KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003921Help
Entry
IscW_ISCW003921   CDS       T01131                                 

Definition
(GenBank) aldehyde dehydrogenase, putative
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00010  Glycolysis / Gluconeogenesis
isc00053  Ascorbate and aldarate metabolism
isc00071  Fatty acid degradation
isc00280  Valine, leucine and isoleucine degradation
isc00310  Lysine degradation
isc00330  Arginine and proline metabolism
isc00340  Histidine metabolism
isc00380  Tryptophan metabolism
isc00410  beta-Alanine metabolism
isc00561  Glycerolipid metabolism
isc00620  Pyruvate metabolism
isc00981  Insect hormone biosynthesis
isc01100  Metabolic pathways
Module
isc_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IscW_ISCW003921
   00053 Ascorbate and aldarate metabolism
    IscW_ISCW003921
   00620 Pyruvate metabolism
    IscW_ISCW003921
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IscW_ISCW003921
   00561 Glycerolipid metabolism
    IscW_ISCW003921
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IscW_ISCW003921
   00310 Lysine degradation
    IscW_ISCW003921
   00330 Arginine and proline metabolism
    IscW_ISCW003921
   00340 Histidine metabolism
    IscW_ISCW003921
   00380 Tryptophan metabolism
    IscW_ISCW003921
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IscW_ISCW003921
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    IscW_ISCW003921
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     IscW_ISCW003921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: EEC06849
VectorBase: ISCW003921
UniProt: B7PJS7
AA seq 457 aa AA seqDB search
GLVTCNIATQEDVDLAVKAARAAFARGSEWRTMDASKRGRMLLKLADLMEENADYLASLE
TVDNGKPFTLSLADVMFASAVIRYYGGYADKVHGNTIPVGDKQCVTYYHHSTYSLSRSFI
GWNVPILMLSWKLGPALAMGNVVVMKPAEQTPLTALAVANLVPKAGFPPGVVNIIPGYGE
TAGAAISGHPDIDKIAFTGSTEIGRLILKASGDSNIKKVSLELGGKSPLIIFPDADLDLA
ATLAHEAVFWNQGQACCAPTRTYVHADVYDKFVAKSVELAKKRIVGDPFDERTSHGAQID
ETQFDRIMEYIGIGQEEGAKLRCGGRRLGSRGYFIEPTVFSDVKDHMKIAREEIFGPVQS
IFKFETTEEVIARANDTMYGLAAGLVTNDLNTANTVAHALEAGVVWVNTFLSMSAQAPFG
GYKMSGIGREMGEDGALEYTEVKTVSFDSAQRLLLRY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ggacttgtgacgtgcaatatcgccactcaggaagatgtggatctggctgtcaaagcagcg
cgagctgccttcgcacgtggttcggaatggaggacaatggacgcgtccaagagaggtcgg
atgcttctcaaactggcggacctgatggaagagaacgccgactaccttgccagtctggaa
acggtggacaacggcaagcctttcaccctctcccttgctgacgtcatgtttgccagcgct
gttatacgctattacggcggatatgctgacaaggtgcatgggaacaccattcctgtcggt
gataaacagtgcgtcacttactaccatcattcaacatattctttatcaaggtcatttatt
ggatggaatgtccccatcctgatgctgagctggaagttgggtcccgccctggcgatggga
aacgtggtggtcatgaaaccagccgagcagacgccactgacggccttggctgtcgcgaac
ctcgtcccgaaagccggatttcctcctggagtggtgaacatcatcccgggatacggcgag
acggcgggagccgccatatcgggtcacccggacatcgacaagatcgccttcacgggatcc
acagagattgggaggctgatactgaaggcatcgggagattccaacatcaaaaaagtttct
ctggaactcggtggcaagagtcctctgattatcttcccggacgctgacttggacttggca
gcgacgttggcccacgaagccgtattctggaaccagggacaggcgtgctgcgccccgaca
cgaacctacgtgcacgccgacgtctacgacaagttcgtggccaagtcggtcgaactggcc
aagaagagaatagtgggagaccccttcgacgaacgcacttcacatggcgcacagattgat
gagacacagttcgaccgtataatggaatacatcggcatcggtcaagaagaaggtgccaaa
ctgcgatgcggggggcgtcgtttgggctccaggggttacttcattgagccgactgtgttt
tcggacgtcaaagaccacatgaagatcgccagggaagagatatttggtccggtccaaagc
atcttcaagttcgaaaccacggaagaagtgatcgcaagagcgaacgacacgatgtacgga
ttggctgcagggctggtgacaaacgacttgaatacagccaataccgttgcacatgctctc
gaggccggcgtagtgtgggtcaacacattcctgtctatgagcgcccaagcacctttcggg
ggctacaagatgtccgggattggtcgagaaatgggcgaagacggagctctcgaatatact
gaagtaaagacagtaagttttgattctgctcagaggcttttgttaagatattga

DBGET integrated database retrieval system