KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004116Help
Entry
IscW_ISCW004116   CDS       T01131                                 

Definition
(GenBank) isocitrate dehydrogenase, putative
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00020  Citrate cycle (TCA cycle)
isc01100  Metabolic pathways
isc01200  Carbon metabolism
isc01210  2-Oxocarboxylic acid metabolism
isc01230  Biosynthesis of amino acids
Module
isc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
isc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IscW_ISCW004116
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     IscW_ISCW004116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh PdxA
Motif
Other DBs
NCBI-ProteinID: EEC06101
VectorBase: ISCW004116
UniProt: B7PHM9
AA seq 362 aa AA seqDB search
PRSCFQAPFLRRTLGPALKRHASTDVRTVTLIPGDGIGPEISASVQEIFKTAGVPIQWEV
VDVTPVKGPDGKFGIPQKAIDSVNKNKIGLKGPLMTPIGKGHRSLNLALRQAFNLYANVR
PCRSIEGYETPYKDVDVVTIRENTEGDFTVDIVMIVTGVVQSIKLITEPASRNIANYAFE
YAKANNRNMVTAVHKANIMRMSDGLFLRCCRDAAERNPTVKYNEMYLDTLCLNMVQDPSK
FDVLVMPNLYGDILSDLCAGLVGGLGVTPSGNIGSDGAIFESVHGTAPDIAGQNKANPTA
LLLSGIMMLRHMKLSNFADVIEVACFDTLREGKYLTADLGGNASCSDFTSEICSKVVAAQ
NK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
ccccgatcctgttttcaggcaccgttcctgaggcgtacccttggccccgccttaaagagg
cacgcctccaccgatgtgcggacggtcacgctcattcctggagacggcattgggccagaa
atttctgcctccgtccaggagatctttaaaacagcaggggtcccgatccagtgggaggtc
gtggacgtcactccagtcaagggtcccgacggcaagttcggcatcccgcagaaggccatc
gactcggttaacaagaacaagatcggcctcaagggccccctcatgacccccatcggcaag
ggccaccgatccctcaaccttgcacttaggcaggcgttcaatctgtatgccaacgtgcgg
ccgtgccgttccatcgagggctacgagacgccgtacaaggacgtggatgtggtcacgatc
cgagagaacacggagggagattttactgtggacattgtaatgatcgtgacgggagtggtt
cagagcatcaagctgatcacggaaccagcgtcgaggaacattgccaactatgcgttcgag
tatgccaaggcaaacaaccgtaacatggtcacagctgtccacaaggccaacatcatgcgg
atgtcggatggcctgtttcttcgctgttgccgggatgctgcagaaaggaatcctaccgta
aagtacaacgagatgtacctggatacgctctgccttaatatggttcaagacccgtctaaa
ttcgacgtactggtcatgcctaacctctatggcgatattctcagcgacttgtgtgccggc
cttgtcggcggattgggagtcacgccgagcggcaacattggttctgacggggccatcttt
gagtcggtccacggtacagccccggacattgccggccagaacaaagccaacccaacggcg
ctgcttctgagcggcatcatgatgttgcgccacatgaagctcagcaactttgccgacgtc
atcgaggtcgcctgcttcgacaccttgcgggaaggaaagtacttgactgccgatttgggc
ggcaatgccagctgttccgacttcacgtccgagatctgctccaaggtggttgctgcgcag
aataaatga

DBGET integrated database retrieval system