KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW004677Help
Entry
IscW_ISCW004677   CDS       T01131                                 

Definition
(RefSeq) alkaline phosphatase, putative
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00730  Thiamine metabolism
isc00790  Folate biosynthesis
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    IscW_ISCW004677
   00790 Folate biosynthesis
    IscW_ISCW004677
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     IscW_ISCW004677
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IscW_ISCW004677
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:isc00537]
 Enzymes
  IscW_ISCW004677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 8051518
NCBI-ProteinID: XP_002433812
VectorBase: ISCW004677
UniProt: B7PF40
AA seq 125 aa AA seqDB search
MKWAQDSGKWTGVVTTTRVTEATPAAAYAHSGHRYWTSKVPKGCEAEDIAYQLVHQEPGS
KLRVVMGGGRDSFLNRTGRGSEHGYRVDGRNLTDDWVRKKKSTGEYVRTRDELLKIDANK
TDYIL
NT seq 376 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggcgcaggactcgggaaagtggaccggtgtggtgacaaccacgcgcgtgacg
gaggcgacgcctgctgccgcctacgcgcattcgggtcaccgttactggacgtctaaggtt
cccaagggctgcgaggcggaggacatcgcttaccagctggtacatcaggagcctggatcc
aagctcagggtggttatgggcggagggagagactcctttctgaataggacggggagaggc
agcgagcatggatatagagtggacgggcgaaacttaaccgatgattgggtgagaaagaaa
aagtcaacaggcgaatacgttagaactagggatgagctgctgaaaattgacgctaacaaa
acagattatatcttgg

DBGET integrated database retrieval system