KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW005411Help
Entry
IscW_ISCW005411   CDS       T01131                                 

Definition
(RefSeq) gem-associated protein, putative
  KO
K13133  gem associated protein 5
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc03013  RNA transport
Module
isc_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:isc00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    IscW_ISCW005411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:isc03019]
    IscW_ISCW005411
   03041 Spliceosome [BR:isc03041]
    IscW_ISCW005411
Messenger RNA biogenesis [BR:isc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     IscW_ISCW005411
   mRNA cycle factors
    P-body specific factors
     IscW_ISCW005411
Spliceosome [BR:isc03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    IscW_ISCW005411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Sec16_C
Motif
Other DBs
NCBI-GeneID: 8051901
NCBI-ProteinID: XP_002435560
VectorBase: ISCW005411
UniProt: B7PP68
AA seq 1374 aa AA seqDB search
MTGACIPPSPNWYCPGVADASDSGLYCFASKNSVVVFDARAGVPELKTSWPVSTERVSCV
AFCRSQRSGADDETPALLTVSDDKSLKVWDVNTRRAHHHTSSTAAVSYADWRGSLSTSVV
FAGGDKGSLFVWDLVSGTVIATPVHAAHPIQLVRSHPTDPDMVAVGYKNGLVVVQGLKKG
SNAVFKLKGHSEEIVSLSWRLGDSSDLDEHPHLCSTALDKTLRIWDVHAEKSTQTLKVPF
SSKSRKVDLSQKGRLWIAAVWVPGTPKQVACSTVCGDICLRDLATADADWEFLSTDDDSA
GHSRCVFNVSLLKTSSRIYAISTSIDRNIVFWDLASKRSAYCLPSLGGYAYHMEFSPVAC
ASLAIGAGDNTLKVWRTDSVVNPYCCSSFWQGVRGRVMVVAWHPRKDNLVAFGTDEGKVG
IVDVLGKQTVVSVSYHRQATYGVCWAELPVGPDKALKTVLLSCGDGKVKVHHLPKMDREA
LDLDSILLKLTSGRTRRITVNYSERLGFLTIANQDGVVDVYEAKTLRKLAVLEAQRKPVE
SLSWHPCQTLSSECRSNFSHWLACSSTNGTIFLYDLSKLASPSADVLRMLQPSLQLSGHS
AKVVCLAWSPFRDGMLASASYDETVQVWDVAQGKPVANYRGHSGRVFSVCWSPLDPDVLF
SGGEDATVNCWKLSEQGSSLPPSKQRKTKSDGDVTSVADETRSVELQSTDCGSTETAKES
KGASEKAGYDTSILKPAGAKSSGTKKKSKSTKSFFPLFSGYENRPKQSGSDDFVLLANLL
SQRDEGCTAPDGLHTHLGMYVDDTGAMAVVDAEIQHHKRELNFDYAFQMMLWKGDVSSAL
QEAAAQRKLTDTLVALSSMVSRATWLDMCQQFAVQLSSDGEHHKAALYLLACHKALEAVQ
LLRKNGLVQEALCIARAHLPEGDSEVTETYVAWAEKACAVGNYEQAAKCHLARGDIKAAV
SMLLNRRDPHSLKSGAYIAKKFGLAADAEVAFSLALRSALVHRDWDAALVLIEEQEKSRA
FVSFVHLHRGLCHAIDRITGAKPDTLEQSAQTDVVLWKSTDAVSAKFLEDVKEAFESNGY
SPLQSTCGFSELSELLGYGQHISKEVLLHESQDQILFQVAGCLTVALFSRNEWKLYVARA
LEAASVSSRSLFAALCKLMFCGEISNSRFTNEIIMDIGLDRFLLFDKLIPEGEAGRTNSF
ECPKSSKDFLERFEVLKGVGSRYDISREALGLYLCMGILDSCDASSFTDSKTAVAEQLSS
LALCPVLACRESTLRQLQEIETRQLKQRLEALTPKNCSTEEAEKGQLSLSDLESRSRAWR
QRWLELKQATEDCLFPDQEKLLARLLELLGGNQDEEGSQLRAKLESWRLLLLNA
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
atgactggggcgtgcattcctccttcgccgaactggtactgccctggcgtcgcagacgct
tctgacagcgggctgtactgcttcgcctccaagaactccgtggtggtgttcgacgctcgc
gctggcgtgcccgaactgaaaacatcgtggccggtgagcacggagcgggtgtcgtgcgtc
gccttctgccgcagccagcggagcggcgccgacgacgaaacaccggcgctgctcaccgta
tccgacgacaagagcctgaaggtgtgggacgtcaacacacgcagggctcatcaccacacg
tcgtccaccgccgcggtgagctacgccgactggaggggcagtctatcgacatccgtggtt
ttcgccggcggggacaagggctcgctgttcgtctgggacttggtgagcgggactgtgata
gcgacaccggtccacgcggcgcaccccattcagctcgttcgatctcacccaacggatccc
gacatggtcgccgtcggctacaagaacggtctggtcgtggtgcagggcttaaagaagggc
agcaacgccgtcttcaaactgaagggacactcggaagagatcgtctccctttcctggagg
ctcggcgattcctcggacctcgacgaacatccgcacctctgttcgacggccctggacaaa
acattgaggatctgggacgtgcacgctgagaagtcaactcagacgctgaaggttccattt
tccagcaagagccgcaaagtggacctgagccagaagggtcgcctctggatcgccgccgtt
tgggttccagggacaccaaaacaggtagcctgctcgaccgtttgtggggacatctgtctc
agggacttggctactgccgacgcggactgggagttcctgtctaccgatgacgactcagca
ggacactcccgttgcgtattcaatgtgtccctgttgaaaacatcatccaggatttacgca
atttctacctccatagaccgcaacattgtgttctgggacctggcgtccaagaggtccgct
tactgcttgccatcgctgggagggtacgcataccacatggaattctcgcctgtcgcttgc
gcctctctcgccatcggagcgggcgacaataccctgaaggtttggaggacggacagtgtg
gtgaacccctactgctgctccagcttctggcagggtgtccgtggcagggtcatggtagtg
gcctggcacccgagaaaagacaacttggtggcctttggcacagacgaagggaaagtggga
attgtagatgtcttaggaaagcagacagtggtttcagtctcctaccaccgacaagcaacc
tatggcgtctgttgggcagaactgcccgtcggtccagataaggctctcaagaccgtttta
ctatcctgtggagatggcaaagtgaaggtccaccatcttccaaagatggacagagaagcc
ttagatcttgacagcattctgctcaagttaacctctggcaggacaaggcgcatcactgtc
aactatagcgagcgcttaggctttctcactattgccaatcaggatggtgtggtggatgtg
tatgaagcaaaaaccctgcggaaactggcagttttggaagcacaaaggaagccagtagag
agcctctcctggcatccctgccagaccctctcctcagagtgcaggagcaacttcagccat
tggcttgcttgttcatccaccaatggaaccatctttctctacgacttatccaagcttgca
tcaccgtctgctgatgtcctgcgcatgttgcaacccagtttgcagctatctggacattct
gccaaggtggtgtgccttgcctggagtcccttcagggatggtatgctggcctctgcctct
tacgatgaaacggtgcaggtttgggacgtggctcaaggcaagcctgtggcaaactaccgg
ggacattccggacgtgtgttcagcgtctgctggagcccgctcgacccggacgtgctcttc
tctggaggagaggatgccactgtgaactgctggaagctttcggagcaaggaagcagtctt
ccaccttccaagcagcgcaagaccaagagtgacggagatgtaaccagtgttgcggatgag
acacgaagcgttgaattgcagtcgacagattgtggctcgactgagacagccaaagaaagc
aagggggcatctgagaaagcaggctacgatacatccattttgaaaccagccggagcaaag
agttcaggcaccaaaaagaagtctaaatcgaccaaatccttttttcctttattttctggg
tatgaaaaccggcccaagcagtctgggtcggacgactttgtgcttctggctaacctcctg
tcccagagggacgaagggtgcactgcccccgatggactgcacactcacctcggcatgtat
gttgacgacaccggagcaatggctgtagtcgatgccgagatccagcaccacaagcgggag
ttaaactttgactatgccttccagatgatgctctggaaaggggacgtctccagtgcactc
caggaggcagctgcccagcgtaagctcacggacacactggtggcactttcgtccatggtg
tcgcgtgccacgtggctggatatgtgtcagcagtttgcagtacagctgtcgagcgatgga
gagcaccacaaggcggcactttaccttttggcgtgccacaaggccctggaggccgtgcag
cttcttcgaaagaatggactcgtccaggaggcgctgtgcattgccagggcccacctgcca
gagggtgacagcgaagtcacggagacatacgtggcttgggcggagaaagcgtgtgccgtg
ggaaactatgagcaggcggccaagtgccaccttgccaggggggacatcaaggccgccgtc
tctatgctgctgaaccgccgagacccccactcgctgaagtcgggcgcctacatcgccaaa
aagtttgggctggccgctgacgcagaagtcgccttctctcttgcgctgcgtagtgctcta
gtccaccgagattgggacgctgccctcgtcttgatagaagaacaggaaaaaagccgagca
ttcgtgagctttgtgcacctacatcgaggcctgtgtcacgctatcgacaggattactggt
gccaaacctgacacactcgagcagtcggcgcaaacagacgtggttctttggaaaagcaca
gatgctgtctctgcaaagttcctggaagatgtcaaagaggcatttgaaagtaatggatac
agcccgcttcagagcacatgcggtttttctgagctgagcgagctcctcgggtacggtcag
cacatctccaaggaagttctcttgcacgagtcacaggaccagatcttgtttcaggttgct
ggctgcctgacggttgctctcttcagtcgaaatgaatggaagttgtacgttgcccgagcg
ctcgaggcagcatctgtaagcagccgttccctctttgctgcactctgcaaactcatgttt
tgcggtgaaataagcaactctaggtttacaaatgaaatcatcatggacataggtctcgat
cgtttccttctctttgataaactgatccccgaaggtgaggccggtaggacaaacagcttc
gagtgccccaaatcgtccaaggatttcttggaacgtttcgaggtcctgaagggagttggc
tctagatacgatataagcagggaagctcttggcctgtacttgtgtatgggcatattagac
agctgcgacgcatcgtctttcaccgactccaagactgctgtggcagaacagctgtcttca
cttgcactctgtccagttctggcttgcagagaaagcaccttgcgtcaacttcaagagatc
gaaacgaggcaactcaagcaacggctcgaagcactaacaccaaagaattgcagcaccgaa
gaagcagaaaaagggcagttgtcgttgagcgacctggaaagccgttctcgggcctggagg
cagcgatggctcgagctcaagcaagccaccgaagattgcttgttcccagaccaggaaaaa
ctgttggcccggttgctggagctgctgggtggcaatcaggatgaggaaggctcccaactc
agagccaaactggagtcctggaggctacttctcctgaatgcctga

DBGET integrated database retrieval system