KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006091Help
Entry
IscW_ISCW006091   CDS       T01131                                 

Definition
(GenBank) rotamase, putative
  KO
K09579  peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 [EC:5.2.1.8]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:isc03110]
    IscW_ISCW006091
Enzymes [BR:isc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     IscW_ISCW006091
Chaperones and folding catalysts [BR:isc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    IscW_ISCW006091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-ProteinID: EEC08397
VectorBase: ISCW006091
UniProt: B7PP75
AA seq 132 aa AA seqDB search
MPPKGKGDSKGGAKGGKSAGKSEEASDSKGKQAKGGTAVKVRHILCEKQSKVLEALEKIK
GGMKFNEAAATYSEDKARQGGDLGWMTRGSMVGPFQDAAFALPISTLANPVYTDPPVKTK
FGYHIIMVEGKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaaggcaaaggagactccaaaggcggtgcgaaaggtggcaaatctgctggc
aaatcggaagaagcctctgattccaaggggaagcaagctaagggtggaactgccgtcaaa
gtgcgacatatcctatgcgagaagcaatcgaaggtgcttgaagcattagagaaaattaaa
ggtggcatgaagttcaacgaggcggcagccacatacagcgaagacaaggcccggcagggt
ggcgatctgggatggatgacgaggggatctatggtgggaccttttcaagatgcagcgttc
gcacttccaatcagtaccttagcaaaccccgtttacacagatccaccagtcaagacgaag
ttcggctaccacatcatcatggtggaggggaaaaagtag

DBGET integrated database retrieval system