KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006436Help
Entry
IscW_ISCW006436   CDS       T01131                                 

Definition
(GenBank) secreted protein, putative
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00601  Glycosphingolipid biosynthesis - lacto and neolacto series
isc00603  Glycosphingolipid biosynthesis - globo and isoglobo series
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    IscW_ISCW006436
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    IscW_ISCW006436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:isc01003]
    IscW_ISCW006436
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     IscW_ISCW006436
Glycosyltransferases [BR:isc01003]
 Glycan extension
  P blood group
   IscW_ISCW006436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-ProteinID: EEC07696
VectorBase: ISCW006436
UniProt: B7PM74
AA seq 293 aa AA seqDB search
AGENAILTDRDLYELTKSGRNFFFLETAGSTCLNSRQSCSIESAARQNPEFTIFLLTLWG
TRRCRYAFMYLDHLQSLRNFRLARIDVNSLVNDTPLNGWYHSDAWIVSPFRTNHFSDALR
LLVLWKYGGVYADLDTLVLRSVANLQNSVSRERFPLIGNSMMSFQKGHPFLLACLQEFAI
NYKPRRWAYNGPRLLERVLKTWCPKEPVMQQPYVDCVDVSILPGEAFYPVSYTEWKLPFQ
ASEASHVAMLLSNSYAIHLWNALSKITRIEEGSAYDVLRKNVCATTYELSISK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gcaggagaaaacgccattttaaccgacagagatctgtacgaactcaccaagtctgggagg
aatttcttcttcctcgagactgctggctcgacctgcctaaacagtcgacagtcgtgcagc
attgaatccgccgcgcgacagaaccctgaattcaccatattcttgctcaccctttggggt
acacggcgctgcaggtacgcattcatgtacttagatcaccttcagagccttcggaacttc
agactggcgaggatagacgtcaacagtctcgtgaacgatacaccgctcaacggatggtac
cacagcgacgcctggattgtgagtcccttccggactaaccacttcagtgacgcattgcgg
cttctcgtgctctggaagtacggtggtgtctacgccgacttggacacgctcgttctcagg
agcgtggccaatctgcagaatagtgtctccagagaacgcttccctctaattggaaacagc
atgatgtccttccagaaggggcatcctttcctccttgcatgtcttcaggaatttgcaatc
aattacaagccgaggcgatgggcttacaacggaccacggctgctggaacgagtcctgaag
acgtggtgtcccaaagagcccgtgatgcagcagccgtacgtcgactgtgtcgacgtcagc
atcctacccggcgaagctttctatccagtgtcctacacggagtggaagcttccatttcaa
gcgtcggaagcgagtcatgtcgcgatgcttctttccaacagttacgccattcacctttgg
aatgcgctcagcaaaatcacaagaatcgaagaggggtcggcctacgacgttcttcggaaa
aatgtctgtgctacaacctatgaactttccatttcaaaataa

DBGET integrated database retrieval system