KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW006965Help
Entry
IscW_ISCW006965   CDS       T01131                                 

Definition
(GenBank) GPI transamidase component PIG-T, putative
  KO
K05292  GPI-anchor transamidase subunit T
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    IscW_ISCW006965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-ProteinID: EEC10888
VectorBase: ISCW006965
UniProt: B7PWB6
AA seq 545 aa AA seqDB search
MLDRSGYSKDTGSVQSTSASQKHVQELHLALTQGRWQHQKWGYPFQEAPPGAHLWAWFND
DVSSVDSAWKDLTHSLSGQLCASLNFIDDTVTVSPKRSFRPQGWVRSHNESLLRYAALPR
ESVCTENLTPWKKFLPCGSKVGLATLLHALQLFTANYMSIALDLKTVCENEECKDAILEL
QMSVSLVFDTVVSQNGYQSWSLSKLFGSGLITTCPLASMSAIYVETSNNGSVGAFKLAPE
PIQFVSTGAGTTKRTFALYDVKHHVRAGRFNLAANYEKPHIYWIVPEPALYASRYIQGYG
LERGGIVNRIHNNDPKKAIRVVFLDIVPWFLRVYVHTLKVSSEGKLITPEHVYYKPGRDR
EQSHHLELTLVLPPASETVLSYDFERAFLKWTEYPPDANHGFYVGSAVLSASLSAPVANY
SGDISLCPTLRHCITGGTASAPFGHEGNLKPHWFVRIYTETLLVSLPTPDFSMPYNVICL
ACTVVALAFGPIHNMATNMLTPVEIKKEGGLLSKLKSRARAIFGRKSQTGGSGDTEISTE
EKKDQ
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgctggatcgcagtggctactccaaggacactggatctgtgcagtccaccagtgccagc
cagaaacacgtccaagaactgcacttggccctcacgcaaggccgatggcaacaccagaaa
tggggatatcctttccaagaagcacctccgggggcacatctctgggcctggttcaatgac
gatgtatcgagtgtcgacagtgcatggaaggacttgacccactcactctctggtcagctc
tgtgcttctctcaacttcattgatgacactgtgacggtgtcacccaagaggtcatttcgg
ccccagggatgggtcaggtcgcacaatgaatccctcctgcgctatgcagcattgcctcga
gagtctgtctgcactgaaaacctcacaccctggaaaaagttcttgccctgtggtagcaaa
gtgggccttgctaccttgcttcatgccttgcaattattcactgccaactacatgtccata
gcgctagatctcaagaccgtttgtgagaacgaagagtgcaaggatgctatactcgagctt
cagatgtcagtctcgcttgtctttgatacagtggtctcccagaatggctatcaaagctgg
tctttgagcaagcttttcggatctggtctcatcacaacctgtccactggcatccatgagc
gccatctacgttgaaacttccaataatgggagtgtgggagcgtttaagcttgcaccagaa
ccaatacagtttgtctccacgggtgcgggcaccaccaaacgtacatttgccctgtacgat
gtcaagcaccatgttcgagctggacgttttaatctggcagcaaactatgagaagcctcac
atctattggattgttccagagccagctctgtatgccagtcgttacattcaaggttatgga
ctagagagaggaggcatcgtcaacaggattcacaacaatgaccctaagaaggccattcga
gttgtctttcttgacattgtcccatggtttctaagagtctacgtgcacacactgaaagtt
tcctctgagggcaaactgatcacaccagagcatgtgtattacaagcctggaagggacagg
gaacagtcgcatcaccttgagctgacactcgtgctgccccctgcttcggaaacggtgctg
tcgtacgactttgagcgggcttttctcaagtggaccgagtatcccccagacgccaatcac
ggattctacgtaggatcggcagtgttgagtgcgtccctgagtgctcctgttgcaaactac
agtggtgacatatctctctgtccaacgctcagacactgcatcactggaggaactgcttcg
gcaccatttgggcatgaaggcaatttgaaaccgcattggtttgttagaatttacacggag
actcttctggtgtccctgcccaccccagacttcagcatgccttacaacgtcatctgcctt
gcctgtactgtggttgctctagcatttgggccaatccacaacatggcaacaaacatgcta
accccggttgaaatcaagaaagaaggcggattactgtcaaagctgaagtccagggcccga
gctatttttggtcgaaagtctcaaacagggggctcaggtgatacagagatctctactgaa
gaaaagaaggatcagtaa

DBGET integrated database retrieval system