KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007750
Entry
IscW_ISCW007750   CDS       T01131                                 

Name
(GenBank) golgi apparatus protein, putative
  KO
K06816  golgi apparatus protein 1
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB
Motif
Pfam: Cys_rich_FGFR
Other DBs
NCBI-ProteinID: EEC09358
VectorBase: ISCW007750
UniProt: B7PRY6
AA seq 1078 aa
KRAAAEHASPASSLRLAETPQCASDLKALCAPSLLTNNFNVLDCVQNAQRKEDAKLSDEC
HHLLWTFRRNVTQDERFTAAAKQFCSNLLKMYPNCDASEKGQLLACLMDHSENATDQQCR
GLLSRMESVVFSDYRLVYRFTEECGEDINRLNCGRISKDPEERHSQGQTIECLSKASEQL
SKSCRKEILHLARIQGEDFHLDRPLFFACREDRQHFCANVASGEGRVYRCLLKHRSDRDM
SQECREKLVQREQLMLQDYRVNQGLSTACFKDIRMYHCRDKTSERREFRLAQILLCLENA
IHNDYPVVPECHREILEHRRFLMENYQLTPDLAAACEADIGHFCRPRLEQNGRTLHCLMR
NSRPTVPGAKRVSDQCRRKLEEVVKLTGAGEDWRVDPVLQEACQPVVDVHCKDVKPGHGR
VMSCLMDHVSSYHMSDNCREALLQIQYFVARDFKLDPVLYKECKTEASTYCKAKKEWHDD
PSRMDPERGPIVLPCLYRYAYHPDKSVRLSKPCLYEIRRVMRQRAVSIDLHPEIEEPCMV
DLASRCSDQLGPGQEMQCLQANLEKLSQECSAAVSNYTEEEAEHLELNYPLYHTCQAVLK
DLCSSALSQDVDQGDLLKCLVDHKNNPRMKEDQACRVSLEHFQLISLKDYRFSFAFKQAC
NKDIHSFCSHVKTGAEMVGCLSKVVLDDVMNEKSPRVSPRCRNQLRVELFQREENIKLDP
KLDTACSSDQRDFCANVSPGEGRMLECLKKHKAKLSRACHLAIFRREQMEAQDNTLDYTL
MAACKPALHRFCSDVEPANALQCLAEHRSDPQLDDRCRGLVQRRLVEQNTDYRLNARLQH
ACRMDIAKFCSALVLDKAAQETELEGKVIQCLKMQFVRRQLTKTCEPVVMGIVRDAARDY
QLDPVLARVCSSEVSFIQNPCKDEQDMEECLKTRFQNRDIKNPECKKEVARLIHEGKADV
QADPILYKACLHDIKHFCHGLTAGHGNLLSCLLTGLESDTVVLTDECRTLLSKRVEMFEY
AAQVAPVETIRDVVQQLANSPSRNYFLVVAMAILGVIFVGGLFCGRVTKRVPASFKNK
NT seq 3237 nt   +upstreamnt  +downstreamnt
aagcgagcggcagccgagcacgcgagcccggccagctctttgagactggccgaaacacct
caatgtgccagtgatttgaaggcgctctgcgctccgagtcttctcacaaacaattttaac
gtgctagactgcgttcaaaacgctcagaggaaagaggatgcgaagttgtccgacgagtgt
catcacctgttgtggacgttcaggcgtaacgttacacaagatgaacgtttcactgcagca
gcaaagcagttctgttcgaatcttctaaaaatgtaccccaactgtgatgcgtcggagaaa
ggccagctcctagcttgcctcatggaccactcggagaatgcaacagatcagcagtgccgg
gggttgctgagtcgcatggagtctgtggtgttttcggactaccgactggtgtaccgcttc
accgaagagtgcggtgaagacataaataggctcaactgcggtcggatctccaaggatccc
gaggagcgtcactcgcagggccagacgattgagtgcctctcgaaggcaagcgagcagctg
agcaagtcatgccgcaaggagatcctgcacctggcccgcatccaaggggaggacttccac
ctcgaccggccgttgttctttgcctgccgtgaggaccggcagcacttctgtgccaacgtg
gcttcgggcgaggggcgcgtctaccgctgcctcctcaagcaccgctcggaccgtgacatg
agccaggagtgccgggagaagctggtgcagcgtgagcagctgatgctacaggactaccgg
gtgaaccagggcctgtcaacagcctgcttcaaggacatccgcatgtaccactgccgggac
aagacttcggagcggcgggagttccgccttgcccagattctcctctgcctcgagaacgcc
attcacaatgactaccctgtggtgccagaatgtcatcgggagattctggagcaccggcgg
tttctcatggagaactaccagctgacgccggacctggctgcagcctgcgaagcagacatt
ggacacttctgtcgtccccggttggagcagaacggccgcactctgcactgcctgatgcgc
aactcgaggccaactgtgccgggtgccaagcgcgtctccgaccagtgccgccgcaagctg
gaagaggttgtcaagttgaccggtgccggggaagactggcgggtggaccccgtgcttcag
gaagcctgccagcccgtcgtcgatgttcattgcaaggatgtcaagcctggccacggcaga
gtcatgtcttgcctcatggaccacgtgagcagctaccacatgagcgacaactgccgggag
gccctgcttcaaattcagtactttgtggctcgagacttcaagctagaccccgtgctgtac
aaggagtgtaagactgaggcctctacatactgcaaggccaagaaggagtggcacgacgac
ccgagcaggatggaccccgagcgggggcccattgtcctgccttgcctctaccgctatgcc
taccaccctgacaagagcgtccggttgtcgaagccgtgcctttacgagatccggcgagtg
atgcgccagcgggcggtctccatcgaccttcatccagagattgaggagccctgtatggtg
gacctggcaagccggtgcagtgaccagctgggacctggccaggagatgcagtgtcttcag
gccaacttggagaaactgagccaagagtgtagtgcggcggtgtccaactacacggaggaa
gaggctgagcacctggagctcaactacccgctctaccacacctgtcaggcagtgctcaag
gacctctgcagcagtgcactgtcccaggacgttgaccaaggagacctgctcaagtgcttg
gtggaccacaaaaacaatccccgcatgaaagaggaccaggcttgtcgcgtctcgctcgag
cacttccagctgatctcactcaaggattacaggtttagctttgcgttcaagcaagcttgt
aacaaggacatccacagcttttgtagtcacgtcaagacaggggcagaaatggttggctgc
cttagcaaagtggtgctagatgatgtgatgaacgagaaatcccccagggtgtcaccacgc
tgcaggaatcaactgagggttgagctcttccaaagggaggagaatatcaagctggaccca
aaactggacacagcctgttcttccgatcaacgagatttctgtgccaacgtcagtcctggg
gaaggcaggatgctggaatgcctgaagaagcacaaggcaaagctgtcgcgtgcctgccac
ctggccatcttccgccgggagcagatggaagctcaagacaacacgctggactacacatta
atggcagcctgcaagccggccttgcaccgcttctgcagcgacgtggagccggccaatgcc
ctgcagtgcttggcagagcatcgctcggacccgcagctggacgatcgctgccggggtctg
gtccaaaggcgtctggtagagcagaacacagactaccggctcaatgccaggctccagcat
gcctgccgcatggacattgccaagttctgctcagcgttggtcctcgacaaggcagcccag
gagactgagcttgagggcaaggttattcagtgcctgaagatgcagtttgttcgacgccaa
ctgacaaagacctgcgagcctgttgtgatgggaatcgtgagggatgctgcacgtgactac
cagctcgaccctgtgctggcccgggtttgctcttctgaggtcagctttatccagaaccct
tgcaaggacgagcaggatatggaagagtgcctcaagactcgtttccagaatagagacatc
aagaatccagagtgcaaaaaggaagtggcccggttgatccacgagggcaaggcagatgtc
caggctgacccgatcttgtacaaagcctgcctgcacgacatcaagcacttctgtcacggg
ctgacggcaggtcacgggaacttgctctcctgcctgcttactggcctggagtctgatacg
gttgttttgactgacgagtgtcggacattgctttccaagagagttgagatgtttgaatat
gctgctcaagttgctcctgtggagacaatccgtgatgtagtacagcagcttgcaaactct
ccctcaagaaactatttccttgtggttgccatggctatcctgggagtcatctttgtgggc
ggactcttctgtgggcgtgtgaccaaacgtgtgcctgccagcttcaagaacaagtga

DBGET integrated database retrieval system