KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW007923Help
Entry
IscW_ISCW007923   CDS       T01131                                 

Definition
(RefSeq) histone deacetylase complex, catalytic component HDA1, putative
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     IscW_ISCW007923
Chromosome and associated proteins [BR:isc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     IscW_ISCW007923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl Rhabdo_NV
Motif
Other DBs
NCBI-GeneID: 8030513
NCBI-ProteinID: XP_002401662
VectorBase: ISCW007923
UniProt: B7PS10
AA seq 413 aa AA seqDB search
MYDQWYYTTFEEDEYSAYPEPCESPPVSVNNLEHTTTAAATTKPRIGYVHSAEHLFECER
LPRIRRRCLLVHGLIKCYGLLKSLYIIRPPQATRNDLLTFHSEDYVDFLETCESAKDLET
TDILDKAIEYNLMDDCPLTDRIFTLVKHIAGGTLSAARALTEGQCDVAIHWEGGWHHAQR
SEAAGFCYVNDVVLGILQLRRRFERVLYVDLDVHHGDGVQDAFCGTDKVATVSFHQYEPC
FYPGTGDCKDVGIGRGRGYSVNVPLRSGMRDPTFVSVVTTVLAEVQRRYDPVAVVCQCGA
DCLSGDPLGAFNLTADALSKCLSFVQAWKLPLLVLGGGGYSFANVARCWTKLTATLLGVN
LDEEIPEHGFLMEYGPGYELGVEPGRRPDLNDSDYVDGVVRAVLSQVRHMDPP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatcaatggtattataccacgttcgaagaggatgaatactctgcgtacccagaa
ccgtgcgaatcgcctccggtgagtgtcaacaacttggagcacaccaccaccgccgccgcc
acaacgaaacctcgtatcggctacgtgcacagcgccgaacaccttttcgagtgcgaaagg
ctgccccgcatccgccgcaggtgcctccttgttcacgggctgatcaagtgctacggtctc
ttgaaatccctttacataatccgccctccgcaggcgacccggaacgatttgttgaccttc
cactcggaagactacgtcgactttctcgaaacgtgcgagtcggcaaaggacctcgaaacg
acggatattctggacaaagccatcgaatacaacctcatggacgactgtccgttgaccgat
cgcatattcacgctcgtgaaacacatcgccggcggcacgctaagcgccgctcgtgccctg
accgaaggacagtgcgacgtcgcgatacactgggaaggcggctggcaccacgctcagagg
agcgaagccgccgggttctgctacgtcaacgacgtcgtgctggggatcctccaacttcgt
cgccgcttcgaacgggtcctctacgtcgacttggacgtgcaccacggcgacggcgttcag
gacgcgttctgcggaaccgacaaagtggccactgtgtcgttccaccagtacgaaccctgc
ttctacccgggaaccggagactgcaaagacgtcggcatcggaagaggccgcggctactcg
gtgaacgtccctcttcgcagcggtatgcgagacccgactttcgtgagtgttgtcacgact
gttctggccgaagttcagcgtcggtacgatcctgtggcagtcgtgtgtcagtgtggggcc
gactgtctttccggcgatccgctcggtgcctttaatctgaccgcggacgctctgtccaag
tgcctgagttttgtgcaggcttggaagttgcccttgctcgtgctgggagggggtggctac
tctttcgctaacgtggcgcggtgttggacgaagctcaccgcgacactgttgggcgtgaac
ttggacgaggagattcccgagcacggctttctgatggagtacggaccagggtacgagctg
ggtgtcgagccgggacgccgacctgacctgaacgattccgactatgtggacggagtcgtg
cgtgccgtgctctcgcaagtacgtcacatggacccgccgtaa

DBGET integrated database retrieval system