KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW011096Help
Entry
IscW_ISCW011096   CDS       T01131                                 

Definition
(GenBank) adenylate and guanylate cyclase, putative
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00230  Purine metabolism
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    IscW_ISCW011096
Enzymes [BR:isc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     IscW_ISCW011096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA
Motif
Other DBs
NCBI-ProteinID: EEC13610
VectorBase: ISCW011096
UniProt: B7Q435
AA seq 457 aa AA seqDB search
MPILLLLKYFCFLNGCRRSLDDGLNAREASLLHEDPRHDDEDQADQDAITDFLQRLAQQA
ASAADLAVSVSTFCRAFPFHFMCDRQLRLTQLGRGLARIFGGRGSAVPSLFVFLEPELLE
MRFDHVVAATNLPFLLQVRDDAIKHQRYKGMEVKGQMVHCPESETLLFLGSPVVDGGLSA
MLRRGLYISDVPVHDATRDILLVEEQARAQDGLKRRMDKIRSSIQEANLAVEEERQKNVD
LLHLIFPPSVARKLWLGESVEAQQHDQVTLLFSDIVGFTAICSTATPMMIETVGDAYCVA
SGLRKQVHTHAQQAAWMALKMMAAAGQVHSHDGKPIQMRIGLHTGLVLAGVVGVKMPRYC
LIGNDVSLANRFESGSVPLRINVSPTTHRLLVQTDGFRFEARPRECLPAGFPEQVKGTCH
FLTAFIHPKLDKSEPLDAHIRKAQRELRMDASQTWLA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcctattgcttctaaaatacttctgcttcctaaatggttgcaggcggtcgctg
gacgacggtttgaatgcccgcgaggcctcgctacttcacgaagacccgcgacacgacgac
gaagaccaggcagaccaggacgccatcacagacttccttcagcgactggcccaacaagca
gcttcggcggcagacctggccgtgtccgtgtccaccttctgccgggccttcccgttccac
ttcatgtgcgaccggcagctccggctgacgcagctcggccggggcctggcgcgcatcttt
ggcgggcggggcagcgccgtgccctcgctgttcgtcttcctcgagcccgagctgctcgag
atgcgcttcgaccacgtggtggccgccaccaacctgcccttcctgctccaggtgcgagac
gacgccatcaagcaccagcgctacaagggtatggaggtcaagggccagatggtccactgt
cccgagtccgagacgctgctcttcctgggctctcccgtggtggacggcggcctgtcggcc
atgctgcgccggggcctgtacatatcggacgtgcccgtgcacgacgccacacgggacatc
ctgctggtcgaggaacaggccagggcccaggacggactcaagaggcgcatggacaagatc
cggagctccatccaggaggccaacctcgccgtcgaagaggagcggcagaagaacgtcgac
ctcctgcacctcatattcccgcccagtgtggccaggaagctttggctgggcgagtccgtc
gaggcccaacagcacgaccaggtgacgctgctgttctcggacatcgtgggcttcacggcc
atctgctcgacggccacgcccatgatgattgagacggtgggcgacgcgtattgcgtggcc
agcggcctgcgcaaacaggtgcacacgcatgcgcaacaggccgcctggatggccctgaag
atgatggccgccgccggtcaagtgcattctcacgacggaaaacccatccagatgcgcatc
ggccttcacacggggctagtgctggccggggttgtgggcgtcaagatgcctcgctactgc
ctcatcggcaacgacgtgtccctggccaacaggttcgagtccggtagcgtgcccctacgt
atcaacgtcagtccgactacccacaggctgctggttcagactgatggtttccggttcgaa
gcccggcctcgggagtgtctgccagctggctttccggagcaggtaaaaggaacgtgccac
tttctgaccgccttcattcatcccaaactggacaagtctgagcccctggacgcccacata
cgcaaggcgcaacgagaactccgcatggatgcctcgcaaacctggcttgcctaa

DBGET integrated database retrieval system