KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW011376
Entry
IscW_ISCW011376   CDS       T01131                                 

Name
(GenBank) multifunctional chaperone, putative
  KO
K06630  14-3-3 protein epsilon
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:isc03400]
    IscW_ISCW011376
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW011376
DNA repair and recombination proteins [BR:isc03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    IscW_ISCW011376
Exosome [BR:isc04147]
 Exosomal proteins
  Proteins found in most exosomes
   IscW_ISCW011376
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-ProteinID: EEC14106
VectorBase: ISCW011376
UniProt: B7Q5I4
AA seq 258 aa
MAEREDNVYKAKLAEQAERYDEMVEAMKRVASLDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGSEGRLEMIRQYRIQVEAELREICQDILDVLDKHLIPTASTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQHDGE
GEGEQKEQVQDVEDQDVS
NT seq 777 nt   +upstreamnt  +downstreamnt
atggccgagagagaagataacgtttacaaggcgaagctagcggaacaggctgaacgttac
gatgaaatggtggaggcgatgaagcgggtggcgtccctggacgtggagctgacggtggag
gagcgcaacctgctctctgtggcctacaagaatgtgatcggggcccggcgtgcctcgtgg
cgcatcatcagctccattgagcagaaggaggagaacaagggctcggagggcaggctcgag
atgatacgccagtaccggatacaggtggaggctgagctcagggagatctgtcaggacatc
ctggacgttctggacaagcacctcatcccaacggcctccactggcgagtcaaaggtcttc
tactacaagatgaagggcgactaccaccgctacctggcggagtttgccacgggcaacgac
cgcaaggaggcggcggagaacagcctggtggcctacaaggcggccagcgacattgccatg
acggagctgcccccgacgcacccgatccggctgggcctggccctcaacttctcggtgttc
tactacgagatcctcaactcacccgaccgggcctgtcggctggccaaggcggccttcgac
gacgccatcgccgagttggacaccctgagcgaggagagctacaaggactccaccctcatc
atgcagctgctcagggacaacctcaccctctggacctccgacatgcagcacgacggagag
ggcgagggggagcagaaagagcaagtgcaagacgtggaagaccaagacgtctcgtaa

DBGET integrated database retrieval system