KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW011552Help
Entry
IscW_ISCW011552   CDS       T01131                                 

Definition
(RefSeq) guanylate kinase, putative
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00230  Purine metabolism
isc01100  Metabolic pathways
Module
isc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    IscW_ISCW011552
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     IscW_ISCW011552
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_18 MMR_HSR1 RsgA_GTPase AAA_21 ABC_tran Rad17 AAA_16 RNA_helicase AAA_29 ATPase_2 NB-ARC FtsK_SpoIIIE NACHT cobW AAA_17 AAA_14 Pox_A32 AAA_24 DUF3734 AAA T2SSE Viral_helicase1 PRK MobB AAA_5 Adeno_IVa2 NTPase_1 GTP_EFTU Dynamin_N AAA_28 Roc AAA_23
Motif
Other DBs
NCBI-GeneID: 8036246
NCBI-ProteinID: XP_002411791
VectorBase: ISCW011552
UniProt: B7Q5M1
AA seq 224 aa AA seqDB search
MFGLVNQAGGLSTLIHMSALRPLVICGPSGSGKSTLLKKLLKDFGDYFALSVSHTTRKPR
PGEVNGKDYHFISRDEMEQAIEAGEFIEYTEFSGNLYGTSKKSVRDVQDQGRICILDIEI
EGVKNIKNTDLNPRYIFIKPPSMKALEERLRGRGTETEESLRKRLARASEEIAYGENQGN
FDLLLVNDNLKTAYSKLKDYLIKEYSVGLSVIQEVEQLQKKPEI
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtctcgtcaatcaagcaggcggtctgtccaccttgattcacatgtccgctctg
cgcccgctggtcatctgcgggccatccggaagcggcaagtccacgttgctcaaaaagctg
ctcaaggactttggtgattacttcgccttgagcgtgtcccacaccacgagaaagccgagg
cctggggaggtaaacggcaaagactaccacttcatcagccgcgacgaaatggagcaggcc
atcgaggcgggggagttcatcgagtacacggagttctcgggcaacctctacggcaccagc
aaaaagtctgtgcgcgacgtccaagaccaagggcgcatctgcattctcgacattgagatt
gaaggggtgaagaacatcaaaaacacagatctgaacccccgctacatcttcatcaagcct
ccgagcatgaaggctcttgaagagcgccttcgaggccgggggacagaaactgaggagagc
ctccggaaacgcctggcacgggccagcgaagaaatcgcctacggtgagaaccagggcaac
tttgatctgctcttggtgaatgacaacctcaagactgcctacagcaagcttaaagattac
ctcataaaggaatacagtgtgggtttgtctgttattcaggaagtggaacaacttcagaag
aagcccgagatctag

DBGET integrated database retrieval system