KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012690Help
Entry
IscW_ISCW012690   CDS       T01131                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00220  Arginine biosynthesis
isc00330  Arginine and proline metabolism
isc01100  Metabolic pathways
isc01230  Biosynthesis of amino acids
Module
isc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    IscW_ISCW012690
   00330 Arginine and proline metabolism
    IscW_ISCW012690
Enzymes [BR:isc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     IscW_ISCW012690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: EEC16290
VectorBase: ISCW012690
UniProt: B7QBR8
AA seq 85 aa AA seqDB search
MGTWDVNKTKQEIGLVGIPVSCGQEKRGVEEGPAFLRAEGLVSRLKDLGHPVRDYGDVKV
EGDSNITSTHAMKSDCVGKTSKNVS
NT seq 256 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgtgggatgttaacaagacaaaacaagaaataggcctcgttggaattcctgtt
agctgtggccaggaaaaacgaggagtcgaagaaggtccggcgtttcttcgagctgaaggc
cttgtgtcgcgcttaaaagatctcggtcacccggttcgagactatggcgacgtcaaagtt
gaaggcgattccaacattacttcaacacatgcgatgaaaagcgattgtgttgggaagact
agcaaaaacgtgagtg

DBGET integrated database retrieval system