KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW012709Help
Entry
IscW_ISCW012709   CDS       T01131                                 

Definition
(RefSeq) cell division cycle regulator protein, putative
  KO
K03350  anaphase-promoting complex subunit 3
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    IscW_ISCW012709
Protein phosphatases and associated proteins [BR:isc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     IscW_ISCW012709
Ubiquitin system [BR:isc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     IscW_ISCW012709
Chromosome and associated proteins [BR:isc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    IscW_ISCW012709
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_12 TPR_8 TPR_19 TPR_7 TPR_14 TPR_6 TPR_11 TPR_16 ANAPC3 TPR_10 TPR_9 TPR_4 HrpB1_HrpK BTAD TPR_15 SRP_TPR_like SNAP DUF2225 PPR
Motif
Other DBs
NCBI-GeneID: 8039457
NCBI-ProteinID: XP_002413455
VectorBase: ISCW012709
UniProt: B7QD41
AA seq 276 aa AA seqDB search
MATRVALEGLMELLQDLGRAQLYLGQYRVKQAIETLQDLPPHQYSTGWVLAALGRAYFEL
GEYDKAVRVFEELRTLEPYRLKGLEYYSTSLWHLQREVHLSTLAQELMDLDKNAATTCAV
AGNCFSLQREHETAVKFLQRAVQVQHALKKTEMSLTTLNSAMTMEPRNPLCKFHRASIFF
SLDRYQEALKELDELKQMVPKESLVYFLCGKVHKKLGNTHLALMNFSWAMDLDPKGANNQ
IKESIDKRGSPEDEDNDASLLSPSAATPHNLRAELV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggccacgcgggtagccctggaggggttgatggagctgctccaggacctggggcgggcc
cagctctacctgggccagtatcgggtcaagcaggccatcgagacgctccaggacctgccc
ccccaccagtacagcacgggctgggtgctggccgcgctgggacgtgcctatttcgagctt
ggcgagtacgacaaggcggtgcgcgtctttgaggagcttcggacgcttgagccctaccgt
ctgaagggcctcgaatactacagcacgtccctgtggcacctgcagagggaggttcatctc
tccacccttgcgcaagagctcatggacttggacaagaacgcagccactacgtgtgcggtg
gcgggcaactgcttcagcctgcagcgggagcacgagacggcggtgaagttcctccagcgg
gcggtgcaggttcagcacgcgctgaagaagacggagatgtccctgacgacgctgaacagt
gccatgacgatggagccccgcaacccgctgtgcaagttccaccgggcgtccatcttcttc
agcctcgaccgctaccaggaggcgctaaaggagctggatgagctcaagcagatggtgccc
aaggagtctctagtctacttcctctgcggaaaggtgcacaagaagctgggcaacacccac
ctggccctgatgaacttctcgtgggccatggacctggaccccaagggtgccaacaaccag
atcaaggagtccatcgacaagcggggtagccccgaagacgaggacaacgacgcctccctg
ctcagccccagtgccgccaccccgcacaacctgcgggcagagctggtctag

DBGET integrated database retrieval system