KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW013147Help
Entry
IscW_ISCW013147   CDS       T01131                                 

Definition
(GenBank) short-chain alcohol dehydrogenase, putative
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00061  Fatty acid biosynthesis
isc01100  Metabolic pathways
isc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IscW_ISCW013147
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     IscW_ISCW013147
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     IscW_ISCW013147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd THF_DHG_CYH_C Polysacc_synt_2 3HCDH_N Glyco_tranf_2_3
Motif
Other DBs
NCBI-ProteinID: EEC16516
VectorBase: ISCW013147
UniProt: B7QCE4
AA seq 297 aa AA seqDB search
MNGRNLSFFVAFLAVETVISQTNGDWDNPGSASHQTECRSLGLDGRLALVTGGASGIGRS
VCMVLAREGATVVVADRNRTGSDETIQMLQASYEGDHRAIYVDVSNPTAVSKLFEEIESS
FPGRNISVVVNSAGIPGVVAPIEEISDAEFDDVILTNLRGTFLIDRASVRHMLSNNVTDG
AIVNIASSLADTGFATLPVYSASKGGVVSLTKAVALEVASKGIRVNAMLPGPVDTPFYAN
FSAELVAKVAQSSPLKRMARPEEISETIGFMCSPKSSFMTGAAVEVTGGITSSASIP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaggaaccttagcttcttcgtggcctttctggcagtcgaaactgtgatcagc
caaacaaacggtgattgggacaaccctggcagtgcgagtcaccagaccgagtgccggtct
ctcggactcgacggccgtctggctcttgttaccggcggtgccagtgggatcggcagaagc
gtctgcatggtgctcgctcgagagggcgccaccgtcgtcgtagcggacaggaacagaacg
ggctctgatgaaaccatacagatgctgcaagcctcatacgaaggcgatcaccgggccatc
tacgtagacgtttccaatccgaccgccgtaagcaagctcttcgaagagatcgagtcgtcg
tttccgggcagaaatatcagcgtcgtggtcaacagcgccggcatccctggagtggtagcg
ccgatcgaagaaataagcgacgccgagtttgacgatgtaatcttaaccaacctaagggga
acgttcctcatagaccgagcgtcggtgaggcacatgctgtctaacaacgtcacggacggc
gccatcgtcaacatcgcgagcagcctagcagacactggctttgccacactccccgtctat
tcagcgtcaaagggcggcgtcgtgtccctcaccaaagctgtggctcttgaagttgccagc
aaaggaatccgcgtcaacgctatgctgccgggccccgtcgacacgcccttctacgccaac
ttttctgcagagctggtggccaaagttgcccagtcatctcccctgaagcgcatggcacgg
cctgaggaaatatccgagacgattgggttcatgtgcagccccaagagcagtttcatgacg
ggcgcggccgtcgaagtcaccggaggaataacatcatcggcctctataccctga

DBGET integrated database retrieval system