KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW016705Help
Entry
IscW_ISCW016705   CDS       T01131                                 

Definition
(RefSeq) lysophospholipase, putative
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00561  Glycerolipid metabolism
isc01100  Metabolic pathways
Module
isc_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    IscW_ISCW016705
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     IscW_ISCW016705
Peptidases [BR:isc01002]
 Serine Peptidases
  Family S33
   IscW_ISCW016705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Esterase Abhydrolase_2 Thioesterase Abhydrolase_3 LCAT Ser_hydrolase Abhydrolase_5 Lipase_3 Abhydrolase_8 PGAP1 DUF900 LIDHydrolase DUF2974
Motif
Other DBs
NCBI-GeneID: 8027120
NCBI-ProteinID: XP_002407145
VectorBase: ISCW016705
UniProt: B7PAS9
AA seq 269 aa AA seqDB search
MTKIWRCRALVFLAHGYAEHSGVPCYETLAMALVGLGCHVFAHDHVGHGKSEGPRAIVDS
VDTYVQDLFTHLDTVRQRYPGKPVYLFGHSMGGLLVAAAALKRPKDYAGVVMMAPLLAMD
KEQATWFRTTMARFLGRIVPNLPISSLDLSLVSKDPAVVNWMTQDPLRYHGLVRVGWAAA
ILKALEEVQSKMETFEVPFLIQHGSADKLCDLGGSELFFKKALSKDKTIKVYNDSYHNLL
MEPDGVGDQVLKDIAEWYATRVPEVSQQA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagatatggcgctgcagggcgctggtattcctggcccacgggtatgcggagcac
agcggcgtcccctgctacgagaccctggccatggccctggtgggcctgggctgccacgtc
ttcgctcacgaccacgtgggccacggcaaaagcgagggtcctcgagccatagtggactct
gtggacacgtacgtgcaggacctcttcacccatctggacacggtccgccagaggtatccc
ggaaaacccgtctacctcttcggacactccatgggaggattgcttgtcgcagcggcggct
ctgaagaggcccaaagattacgccggcgtcgtgatgatggcgcctcttttggccatggac
aaggagcaggccacgtggtttaggacaaccatggccaggtttttggggaggatcgtgccc
aaccttcccatttcatcgctggatctcagtctggtgtccaaggaccctgcggtggtcaac
tggatgactcaagacccgctccgttatcacggccttgtgcgggtcggctgggcggccgcc
atattaaaggcgttagaggaagtccagtccaagatggagacattcgaggtgcccttcctg
attcaacatggctcagccgacaagctctgcgacctggggggctccgagttattcttcaag
aaggcgctcagcaaggacaagaccatcaaagtgtacaacgacagctaccacaacctgctc
atggaacccgacggtgtcggagaccaagtgctcaaggacatcgcggagtggtacgccacc
agggtacccgaggtatcgcagcaggcgtag

DBGET integrated database retrieval system