KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW017453Help
Entry
IscW_ISCW017453   CDS       T01131                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:isc01002]
    IscW_ISCW017453
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:isc03036]
    IscW_ISCW017453
Enzymes [BR:isc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     IscW_ISCW017453
Peptidases [BR:isc01002]
 Cysteine Peptidases
  Family C50: separase family
   IscW_ISCW017453
Chromosome and associated proteins [BR:isc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    IscW_ISCW017453
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 8027103
NCBI-ProteinID: XP_002407129
VectorBase: ISCW017453
UniProt: B7PAR3
AA seq 365 aa AA seqDB search
MKMTEPSLWWSVRRGLDKRLKELLKSIEEVWMGCWKGVFQGKIADATAYQALKSSVTTVL
VKAAKYKLHCCNKRLLEAVLDSDLTAYQLSVAVCRLFGIAHSHPAHDSLVQLMQLRAVKD
NPERHPVILILDKAIQALPWESVPILQKNPVSRVPSLAYLQAQLWYYSQTLDNVYIRGAD
TSKTYFILNPSNDIPKTQAQFENVFKGQGWPGVIGQPPQKEEFQAAIAGKDVILYCGHGS
GREYLSGDLIEQTLCRACPILMGCGSGRLKVSGPKIEPWGVVLQYWLGGSPCVVANLWDV
TDRDIDRFTEGLLTSWIPTLVTKTHVPDITKAVQVARKACKLQYLIGAAPVVYGIPVHSM
GARQS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaccgagccttcactgtggtggtctgtgcggcgtggactggacaagcgcctt
aaggagcttttgaagtccattgaagaggtctggatgggctgctggaaaggtgtcttccag
gggaagattgcagatgccactgcctaccaagccctcaagtcaagcgtgaccacagttctt
gtgaaggctgccaagtacaagctgcactgctgcaataagcgtctgctagaggcggtgctc
gactctgacctgaccgcctaccagctgtctgttgctgtgtgtcgtctgtttggcattgca
cactcccatcccgcccacgacagtctggtgcagctcatgcagctgcgagcggtcaaggac
aacccagagcggcacccggtcattctcatacttgacaaggccatccaagccctgccctgg
gagagtgtgcccatcctgcagaagaaccccgtgagccgggtcccgtcactggcctacctc
caggcccagctgtggtactactcccagactttagacaatgtctacattcggggggccgac
acgtctaaaacctacttcatcctgaaccccagcaacgatatccccaagacccaggcccag
ttcgagaatgtcttcaaagggcagggttggccaggagtgattggacagcccccacagaag
gaggagttccaagccgccattgctgggaaggatgtgattttgtactgcggccacggctcc
ggccgcgaatacctgagcggggacctgattgagcagacgctgtgccgtgcatgccccatc
ctcatgggctgtggcagtgggcgcctcaaggtgtctggccccaagattgagccctgggga
gtggtcctgcagtactggctgggcggcagtccttgcgtcgttgccaacttatgggacgtg
accgacagggacattgatcggttcacggagggacttctgacgtcttggattcccacgctg
gtgacaaagacgcacgttcccgacatcaccaaggctgtgcaagtggccagaaaagcctgc
aagctgcagtacctcataggggctgctcccgtcgtctatgggatccctgtacacagcatg
ggtgctcgacagtcgtga

DBGET integrated database retrieval system