KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW018873Help
Entry
IscW_ISCW018873   CDS       T01131                                 

Definition
(GenBank) short-chain alcohol dehydrogenase, putative
  KO
K08683  3-hydroxyacyl-CoA dehydrogenase / 3-hydroxy-2-methylbutyryl-CoA dehydrogenase [EC:1.1.1.35 1.1.1.178]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00280  Valine, leucine and isoleucine degradation
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IscW_ISCW018873
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:isc03029]
    IscW_ISCW018873
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW018873
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     IscW_ISCW018873
    1.1.1.178  3-hydroxy-2-methylbutyryl-CoA dehydrogenase
     IscW_ISCW018873
Mitochondrial biogenesis [BR:isc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial ribonuclease P
    IscW_ISCW018873
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   IscW_ISCW018873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Motif
Other DBs
NCBI-ProteinID: EEC08316
VectorBase: ISCW018873
UniProt: B7PNZ4
AA seq 257 aa AA seqDB search
MGLVALVTGGASGLGKATAARLVRQGARVAIFDLPTSKGESVAKEIGDGCIFTPGNVTSE
DDVKKALSTVQQKYEKLDVTVNCAGIGVAFKVYNFNKNLPHSLEDFTKVIMVNTVGTFNV
LRLAVGLIGQNAPGPDGRRGVVVNTASVAAFEGQIGQVAYSASKGGIVGMTVPLARDLAP
QASGSAPSHQVRRHGLFHTPLLEALPEKVRTFLAETIPFPKRLGDPDEYAHLVQSIIENP
LLNGEVIRLDGALRMVS
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggttgccctggtgaccggcggggcttctggcctgggcaaggcgactgccgcc
aggctggtccgccagggggcccgggtggccatctttgacctgcccacctccaagggggaa
agcgtggccaaggagattggcgacggatgcatcttcactcccggcaatgtcacctcggag
gacgatgtcaagaaggccctgtccacagtccaacagaagtacgagaaactagacgtgaca
gtcaactgtgcaggcatcggggtggctttcaaggtgtacaacttcaacaagaacttgccc
cattccctggaggacttcaccaaggtcatcatggtgaacactgtgggcactttcaacgtg
ctgcggctggccgtgggactcattgggcagaatgccccgggaccggatggccggcgtggc
gtggtggtgaacacagcgagcgtggcggccttcgagggccagatagggcaggtggcctac
agcgcctccaaaggcggcatcgtgggcatgacggttcccctggccagggacctggccccg
caggcatccgggtctgcaccatcgcaccaggtgaggcggcatggcctcttccacaccccg
ctgctggaagctcttccggagaaggtgcgcacgttcctggcggagacgatccccttcccc
aagcgcctgggggacccggacgaatatgcgcacctggtgcagtccatcatcgagaacccg
ctgctcaacggggaggtcatcagactggacggagccctgcgcatggtcagctag

DBGET integrated database retrieval system