KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW019756Help
Entry
IscW_ISCW019756   CDS       T01131                                 

Definition
(RefSeq) long-chain-fatty-acid CoA ligase, putative
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00061  Fatty acid biosynthesis
isc00071  Fatty acid degradation
isc01100  Metabolic pathways
isc01212  Fatty acid metabolism
isc04146  Peroxisome
Module
isc_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IscW_ISCW019756
   00071 Fatty acid degradation
    IscW_ISCW019756
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    IscW_ISCW019756
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:isc01004]
    IscW_ISCW019756
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW019756
Enzymes [BR:isc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     IscW_ISCW019756
Lipid biosynthesis proteins [BR:isc01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   IscW_ISCW019756
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   IscW_ISCW019756
  Exosomal proteins of breast cancer cells
   IscW_ISCW019756
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding LRR_10
Motif
Other DBs
NCBI-GeneID: 8030914
NCBI-ProteinID: XP_002403481
VectorBase: ISCW019756
UniProt: B7PT08
AA seq 184 aa AA seqDB search
MVGTGSAPLAVDTDAFIRACLDCCPVGGYGLTETAGSATLKDMDDQSFGRVGSPILGSYV
KLVNWDEGDYRVSDKPHPRGEIVVGGDCVTQGYFKNETLTKEYFKKEDGMQWFYTGDIGE
LYPDGTFSIIDRKKDLLKLQHGEYVSLGKPDTGLVTAAYKIRRREIEKFYRNEINEMYGM
NKFP
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggtgggcactggatctgctccacttgctgtggatacagacgcgttcatcagggcgtgc
ctcgattgctgtcctgtgggaggctatggtcttacggagactgctggttctgccacactc
aaggacatggacgatcagagtttcgggcgagtcgggtcgccgattctcggtagctacgtc
aaattggtcaactgggacgaaggcgactatcgcgtctccgacaaaccacatcctaggggc
gagatagtagttggcggagattgcgtgacgcaaggatattttaaaaatgagactcttacc
aaggagtatttcaagaaagaggacggcatgcaatggttctacaccggagacatcggggaa
ttgtaccctgacggcaccttcagtatcatcgaccgtaaaaaggacctgctgaagcttcag
cacggagaatatgtatctctgggaaaaccggacactggtctcgtgacggcggcctacaag
attcgaaggcgagaaatcgaaaaattctatcgcaatgaaatcaacgagatgtatgggatg
aacaagtttccttaa

DBGET integrated database retrieval system