KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020577Help
Entry
IscW_ISCW020577   CDS       T01131                                 

Definition
(RefSeq) Jun-N-terminal kinase, putative
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc04068  FoxO signaling pathway
isc04137  Mitophagy - animal
isc04140  Autophagy - animal
isc04141  Protein processing in endoplasmic reticulum
isc04310  Wnt signaling pathway
isc04933  AGE-RAGE signaling pathway in diabetic complications
Module
isc_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:isc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    IscW_ISCW020577
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    IscW_ISCW020577
   04068 FoxO signaling pathway
    IscW_ISCW020577
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    IscW_ISCW020577
   04137 Mitophagy - animal
    IscW_ISCW020577
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    IscW_ISCW020577
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     IscW_ISCW020577
Protein kinases [BR:isc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   IscW_ISCW020577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 8034306
NCBI-ProteinID: XP_002408829
VectorBase: ISCW020577
UniProt: B7Q122
AA seq 411 aa AA seqDB search
MSKHSSLFYTFEVNDTKFTILRRYQNLKSIGSGAQGIVCAAYDSVTGHNVAIKKLSRPFQ
NVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQKTLEEFQDVYLVMELMDANLCQVIQMD
LDHERMSYLLYQMLCGIKHLHLAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMM
TPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGAVLFPGTDHIDQWNKIIEQLG
TPSQEFMRRLQPTVRNYVENRPRYAGYPFDKLFPDVLFPSDSPEHSKLKASQARDLLSKM
LVIDPERRISVDDALAHPYINVWFDETEVNAPAPAAYDHSVDEREHTVEQWKELIYKEVL
EYEQTHNSIGTSGRNALHGSQDGAIEAEAGLSTDQSANGAANSYQRRRYQS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcactccagcctcttctacacctttgaagtgaacgacaccaagtttaccatc
ctgaggaggtaccagaacctcaagtccatcggctcaggcgcacagggcattgtctgtgcg
gcctatgactccgtgactggtcacaatgtggccatcaagaagttgagccgacccttccag
aatgtgacccatgccaagcgggcctaccgcgagttcaaactcatgaagctggttaaccat
aaaaatatcataggtcttctaaatgcattcacaccacaaaagacgctagaagagttccaa
gacgtgtacttggtgatggagctgatggatgccaacctgtgccaggtgatccagatggac
ctggatcacgagcgcatgtcctacctgctctaccagatgctctgtggcatcaagcaccta
cacttggctggcattatccacagggacctgaaaccgagcaacatagtggtgaaatcagat
tgcacgctcaagatcctggactttggactggctcgcacagccggcaccagtttcatgatg
accccctacgtggtgacccgctactacagggccccagaggtcatcttaggcatgggctac
aaggaaaatgtggacatctggtcggtcggctgcatcatgggggagatgatccgaggtgcg
gtgctctttccgggcacggaccacattgaccagtggaacaagatcattgagcagctgggc
accccgtcccaggagttcatgcggcgcctgcagcccacagtgcgcaactatgtggaaaac
cgtccccggtatgcaggctaccccttcgacaagctcttcccggacgtcctcttccccagc
gacagccccgagcacagtaagctcaaggcgagccaggcgcgcgacctcctgtcgaagatg
ctcgtgatcgatcccgagaggcgcatctcggtggacgacgccttggcccacccatacatc
aacgtatggttcgacgagactgaagtgaacgcgccagccccggcggcttacgaccactcg
gtagacgagcgggaacacacggtggaacagtggaaggagctgatctacaaggaagtgctt
gagtatgagcagacgcacaacagcataggcacgtccggccgcaacgccctccacggctct
caagatggtgcaatagaagcggaggctggcctgtccacggaccagtctgccaacggggcg
gccaacagctaccagcggcggcgctaccagtcctag

DBGET integrated database retrieval system