KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW020637Help
Entry
IscW_ISCW020637   CDS       T01131                                 

Definition
(RefSeq) serine/threonine protein kinase, putative
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc04068  FoxO signaling pathway
isc04140  Autophagy - animal
isc04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:isc00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    IscW_ISCW020637
   04150 mTOR signaling pathway
    IscW_ISCW020637
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    IscW_ISCW020637
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     IscW_ISCW020637
Protein kinases [BR:isc01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   IscW_ISCW020637
Membrane trafficking [BR:isc04131]
 Autophagy
  Other autophagy associated proteins
   Others
    IscW_ISCW020637
Mitochondrial biogenesis [BR:isc03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    IscW_ISCW020637
  Mitophagy factors
   Other mitophagy factors
    IscW_ISCW020637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 YukC Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 8034988
NCBI-ProteinID: XP_002410911
VectorBase: ISCW020637
UniProt: B7Q2N1
AA seq 510 aa AA seqDB search
MADKNQPQGAQGQPLVKIGHYILGETLGVGTFGKVKTACHQLTGHKVAVKILNRQKIKNL
DVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMIMEYVCGGELFDYIVKHGKLKESD
ARRFFQQIISGVAYCHRHMVVHRDLKPENLLLDQNLNVKIADFGLSNMMMDGEFLRTSCG
SPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFRKIKSGIFPVPD
YLNKSVVSLLIHTLQVDPMKRATMEDIKNHDWFKKDLPAYLFPLPNDNDASIIDMDAVKV
VCEKFGVQEKELHSALLSGNPHDQLAIAYNLVVDNKRIEDETAKLEIKDFYVASSPPPTA
ALLDQSPSRPHPERIASRQRMLSGGNGADRKGTPMKRAKWHLGIRSQSKPHDIMNEVYRA
MKALDFEWKVVNSFHVRVRRKNPSNARPVKMSLQLYQVEYKSFLLDFKSLPTNEEAQSQD
PSVAETSYNQVHNTMEFFEMCAALITQLAR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcggacaagaaccaacctcaaggagcccaagggcaacctttagttaaaatagggcat
tatattctaggagaaaccctcggcgtcggcacgtttggaaaagtgaagaccgcctgccac
cagttgacgggccacaaggttgcagtgaagatattgaacagacagaagataaagaatctc
gatgtcgtgggcaagatccgccgtgaaatacaaaacctcaagctcttccgacaccctcat
atcatcaaactataccaagtcatcagcacacccaccgacattttcatgatcatggagtat
gtctgcggtggtgaactctttgattacatcgtcaagcatgggaagctgaaggagtcggac
gcccggaggttcttccagcagatcatctccggagtggcgtactgtcacaggcacatggtg
gtccacagggacctgaaacccgaaaacctgctcttggaccagaacctcaacgtcaagatc
gccgacttcggactctcgaacatgatgatggacggcgaattcctgaggacgagctgcggg
tccccaaattacgcagccccagaggtcatctcgggcaaactctacgccggtcctgaagtg
gacatttggagctgcggtgtaatactctatgcgctgctctgcggaacccttccatttgac
gacgaacatgtcccgacccttttccgaaagatcaagtcgggcatcttccccgtcccggac
tacctgaacaaatcggtggtgagcctgttgatccacaccctccaagtggacccaatgaaa
cgggcaaccatggaggacatcaaaaaccacgactggtttaagaaggacctcccagcctac
ctcttcccgttgccgaacgacaacgatgcgtcgatcatcgacatggacgccgtgaaagtc
gtctgtgagaagtttggggtgcaggagaaggagctgcacagcgccctgctgagtggcaac
ccccacgaccagctggccatcgcctacaacctggtggtggacaacaagcgcatcgaagac
gagacggccaagctggagatcaaggacttctacgttgcgtccagcccacccccgacggcc
gctctgctcgaccaaagcccatcgaggcctcaccctgagcgaatcgccagccgccagcgg
atgttgagcggagggaacggcgcggaccgcaagggaaccccgatgaagagggcaaagtgg
catctgggcattcgatcgcagagcaagccacacgacatcatgaatgaagtgtacagggcc
atgaaagcgcttgatttcgagtggaaagtggtcaactcatttcacgttcgggtacggaga
aaaaaccccagcaatgctcggccggtgaagatgagcctgcagctgtaccaagtggagtac
aagagtttccttctcgacttcaaatcccttcccaccaacgaggaggctcagtcccaggac
cccagtgtggcggaaaccagctacaaccaggtgcacaacacaatggagttcttcgagatg
tgtgccgccctcatcactcagctggcgcgttga

DBGET integrated database retrieval system