KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021412Help
Entry
IscW_ISCW021412   CDS       T01131                                 

Definition
(GenBank) MAP kinase phosphatase 5, putative
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:isc01009]
    IscW_ISCW021412
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     IscW_ISCW021412
    3.1.3.48  protein-tyrosine-phosphatase
     IscW_ISCW021412
Protein phosphatases and associated proteins [BR:isc01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    IscW_ISCW021412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT PTP2
Motif
Other DBs
NCBI-ProteinID: EEC14371
VectorBase: ISCW021412
UniProt: B7Q680
AA seq 428 aa AA seqDB search
MRHVTLLRKSAKPSPAVHPPSSRSATRELQTSPRNSLSQHGGGVGIAVASSQVHRQGGGD
PFWPCLSHPPLPWPGPKARTPEGSSTSSATSSEPCGRVVRLLTPTELVDSWYRDCGPRLL
LVDCRPFLSFNAGRIKSAVNVNCGDRITRRRLQQGRLALWDLVACGQAREQLRRARDIVV
YDDCTGDLECPQPSSSLSLVLAVLCQNGAKPAVLKGGFKEFQRQYAHECTSSASPEDSGS
PPEPVDKDLTAWPVTRVLPFLFLGNERDARDADLLDRLGVGYVLHVTTTPPPGLQARHGP
GLRCKRLPASDSCHQNLKQFFEEAFAFLDEAHANGSRVLVHCHAGISRSPTITVAYLMRH
LRLPLVDAYRYLKAKRPIISPNLNFMGQLMELEQNLAQQPEQAPCAQCCRASATLLQLLA
AEPTCAGV
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcggcacgtcaccttgctccggaagagcgccaaaccgagccctgcggtgcaccctccc
tcctcccgttccgcaacgcgcgagcttcaaacgtctcctcgcaactctctgagtcagcac
ggcggcggcgtcgggatcgctgtagcgtcgtcgcaggtgcatcggcaggggggaggggac
cccttttggccgtgcctgagtcacccgccgctgccttggcccggacccaaggctagaacc
cccgaagggtcctcgaccagcagtgccacgtcctccgaaccctgcggacgggtcgtgcgc
ctcctgacgcccacggaactagtcgactcctggtaccgggactgtggacctcggctactc
ctggtggactgtcggcccttcctgagcttcaacgcgggccgcatcaagtctgctgtgaac
gttaactgcggcgaccgcattacgagacggcgactgcagcaaggacgtcttgccctgtgg
gatctggtggcgtgcggacaggccagggagcaactccgtcgcgcgcgggacattgtggtc
tacgacgactgcacgggagacttggagtgtccgcagccgtcgagctccttgtcgctggtg
ctcgcggtgctctgccagaacggcgccaagccggccgtgctcaaaggcggcttcaaggag
ttccagcggcagtacgcgcacgagtgcaccagttccgcgagccccgaggactccggttca
ccgccggagcccgtggacaaggacctgacggcgtggcccgtgacccgggtcctcccgttc
ctcttcctgggcaacgagcgggacgcccgggacgccgacctcctggaccgcctcggcgtc
ggctacgtcctccacgtgacgaccaccccgccgccagggctccaggccaggcacggtccg
ggacttcgctgcaaacgtcttcccgcctccgacagttgccaccagaacctcaagcagttc
ttcgaggaggcgttcgccttcctagacgaggcccacgccaacggcagccgtgtgctggtc
cactgccacgcgggcatctcccgctcgccaaccataacggtggcctaccttatgcgccac
ctgcgactgcccctggtggatgcgtaccgctacctcaaggccaagcgacccatcatctcg
cccaacctcaacttcatgggacagctcatggagctcgaacagaacctggcccagcagccc
gaacaggcgccgtgcgcccagtgttgccgggcttctgccacgctgctccagctgctcgcc
gccgaaccgacctgcgccggcgtctga

DBGET integrated database retrieval system