KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021913Help
Entry
IscW_ISCW021913   CDS       T01131                                 

Definition
(RefSeq) acetyl-CoA carboxylase, putative
  KO
K11262  acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14 2.1.3.15]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00061  Fatty acid biosynthesis
isc00620  Pyruvate metabolism
isc00640  Propanoate metabolism
isc01100  Metabolic pathways
isc01212  Fatty acid metabolism
Module
isc_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IscW_ISCW021913
   00640 Propanoate metabolism
    IscW_ISCW021913
  Lipid metabolism
   00061 Fatty acid biosynthesis
    IscW_ISCW021913
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    IscW_ISCW021913
Enzymes [BR:isc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     IscW_ISCW021913
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     IscW_ISCW021913
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     IscW_ISCW021913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carboxyl_trans ACC_central
Motif
Other DBs
NCBI-GeneID: 8038327
NCBI-ProteinID: XP_002412555
VectorBase: ISCW021913
UniProt: B7QAH9
AA seq 859 aa AA seqDB search
RRFPQYYTYRYRDDYIEDRIYRHLEPALAFQLEINRLRNYDLEAIPTSNLKMHLYLGKAK
VPKGQEVADFRFFIRAIIRHSDLITKTVSLTGLRKTGQRAIGTASRNARHIFGSLSVLSI
IRSHVDRPVHCPTRINKTAQKKTRGQVEDERKALVRLTLHPFFCAVLLMPSLNGKCLPIR
LFLANESGYYLDISLYKEVVDPETGQMQFEAWGHHRQGPLHGLPISTPYLTKDYLQQKRF
QAQSNGTTYVYDFPEMFRQVGMVAWRMTMVTPEYPEGRDVIVIANDITYLLGTFGPQEDI
LFFKASERARALGIPRLYISANSGARIGLAEELKHLFNVAWVDPEIPDKGYRYLYLTPEN
FKKVSAMNSVNAELIDDEGEKRYKITNIIGKTDGLGVENLKYAGLIAGETSQAYEEIVTI
SLVTCRAIGIGAYLVRLGQRVIQLENSHIILTGAGALNKVNGPFRALLHDGRKVFVVSAL
LVLSTSYKCSRVTFCSQVSIPLCLLFIDCKGAPLPIVEPLDPIDRDVVYTPSKVPYDPRW
LVAGRESPTLAGFWEDGFFDRGSFMEIMQQWAQTVVCGRARLGGIPVGVVAVETRTVEID
VPADPANLDSEAKVLSQAGQVWFPDSAYKTAQAINDFNREELPLFVFANWRGFSGGMKDM
YDQVLKFGAYIVDALHNYRQPVLVYIPPFGELRGGAWAVVDAAINPRMMEMYADPDSRGG
VLEPEGTVEIRFRKKDLVKVMHRVDGPCRDLLARLGTVEASEKAALEAQLRKRETQLLPM
YHQVALSFADLHDMPARMQEKGVIQDEIPWAKSRTQLYWRLRRRLLQDRAKRDILQVRPQ
LSDGEMESMLRRWFVESLG
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
cgccggtttccccagtactacacgtaccggtaccgggacgactacatcgaggaccgcatc
taccggcatctggagccggcgctggcattccagcttgagataaaccggctgcgcaactac
gacctggaggccatccccacctccaacctcaagatgcacctgtaccttggaaaggccaag
gtgccaaaaggtcaggaagttgccgacttccgcttcttcatccgtgcgatcatcaggcat
tctgacctcatcacaaagacagtctcgctgaccggtcttcggaagactggtcagcgagct
attggaaccgcgtccaggaacgctcgccacatctttgggagtttgtccgttctatcgatc
attcgctcgcatgtcgaccgcccggtgcattgtccgacgagaataaataaaacggcgcaa
aagaagacacggggacaagtggaagacgaacgcaaagcgcttgtccgcttgactctgcat
ccttttttttgcgccgttttattgatgccgagcctgaacggcaagtgcctgccgatccgg
ctgttcctggccaacgagagcggctactacctggacatcagcctgtacaaggaggtggtg
gaccccgagacgggccagatgcagttcgaggcctggggccaccaccgccaggggcccctg
cacggcctgcccatctccaccccgtacctcaccaaggactacctgcagcagaagcgcttc
caggcacagtccaacgggaccacctacgtctacgacttcccagagatgttcagacaggtt
ggcatggtggcatggcgcatgaccatggtgacgccggagtacccggagggccgtgacgtg
attgtgattgccaacgacatcacctacctgctgggcacctttggtccccaggaagacatc
ctgtttttcaaagcttcggaaagagcccgagccctcggcattccccggctatacatctcg
gccaacagtggagccaggattggtctcgccgaagaactaaagcacctcttcaacgtggcc
tgggttgaccccgagattcccgacaagggctaccggtatctctacctcacccccgaaaac
ttcaagaaagtgagtgccatgaactccgtcaacgccgagctcattgacgacgagggagag
aagcgctacaagatcaccaacatcattggtaagacggatggtcttggcgtggagaacctt
aagtatgccggcttgattgctggcgaaacgtctcaagcttacgaagagatcgtcaccatc
agtttggtgacctgtcgtgccatcggcattggtgcctacctggtgcgcctgggccagagg
gtgattcagctggagaactcccacattatcctgacgggtgccggtgccctgaacaaggtg
aatggcccttttcgagcgttgttgcacgatggtcgtaaggtattcgtcgtaagtgctctg
cttgtattatccacaagttataagtgctctcgcgtgacgttttgttcccaagtaagcatt
cccctctgcctgctttttattgattgcaagggggcgccgttgcccattgtggagccactg
gacccgattgaccgtgacgtggtgtacacgccgtccaaggtgccgtacgacccgcgctgg
ctcgtcgcgggacgggaaagtcccaccctggcgggcttctgggaggacggcttcttcgac
cggggctccttcatggagatcatgcagcagtgggcccagacggtggtgtgcggccgggcc
cgcctcggaggcatccccgtcggggtggtggccgtcgagacgcgcaccgtcgagatcgac
gtgcccgcggaccccgccaacctagactctgaggccaaggtcctgtcgcaagcggggcag
gtgtggttccccgactccgcatacaagaccgcccaggccatcaacgacttcaaccgggaa
gagctgcctctcttcgtctttgccaactggcggggcttctcgggaggcatgaaagacatg
tatgaccaggtgctgaagttcggggcctacatagtggacgcgctgcacaactaccggcag
cccgtgctggtgtacatcccgcccttcggtgagctcagaggcggtgcgtgggccgtagtg
gacgccgccatcaaccccagaatgatggagatgtacgccgaccccgacagcaggggcggt
gtgctggagcccgagggcacagtggagatccgcttccgcaagaaggacttggtgaaggtg
atgcaccgggtggacgggccctgccgggacctgctggcccggctgggaacggtcgaggcc
tcggagaaggcggccctggaggcccagctgcgcaagcgggagacccagctgctgcccatg
taccaccaggtggccctgtcgtttgccgacctgcacgacatgcccgcacgcatgcaggag
aagggcgtcattcaggacgagattccgtgggccaagtctcggacgcagctgtactggcgc
ctgaggcgacgcctgctgcaggaccgcgccaagcgggacatcttgcaagtgcgaccccag
ctgagcgacggcgagatggagagcatgcttcgccgctggttcgtcgagtccctcggc

DBGET integrated database retrieval system