KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW021926Help
Entry
IscW_ISCW021926   CDS       T01131                                 

Definition
(RefSeq) sphingosine kinase, putative
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00600  Sphingolipid metabolism
isc01100  Metabolic pathways
Module
isc_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    IscW_ISCW021926
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     IscW_ISCW021926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 8038252
NCBI-ProteinID: XP_002400318
VectorBase: ISCW021926
UniProt: B7QAB7
AA seq 286 aa AA seqDB search
TERQNHAKEFIKSLNLKQWSGILVISGDGLLFEVYNGLMERPDWEQAVKIPIGIIPGGSG
NGLARSISHTANDPIVAATLGVAKGRISPLDLMLVETPKGALYSFLTVGWGIMADIDIES
ERLRAIGEIRFTLWAFWRVFNLRTYQGRISYLPATVPPKNGPTVAETPLAPPDGFPSLDD
PVPDDWTVEEGRFIIIYSSLQSHLGTNLFFAPEARLDDGVAWLLMIRGDATRLQLLTYFK
AQEEGHHVDLPYVRLIPVRAFRLEAFANSTVTVDGELVRTKVGGGS
NT seq 859 nt NT seq  +upstreamnt  +downstreamnt
acagagcggcaaaaccatgcgaaggagttcatcaagagcctgaatctgaagcagtggagt
ggaatcctggtgatctcgggcgatggacttctctttgaggtctacaacggactgatggag
cgtccggactgggagcaggctgtcaagattccaatcggcatcattccggggggctcgggc
aatggcctggctcgcagcatcagccacactgcaaacgacccgattgtggcggcaacactg
ggcgtggccaagggccgcatctctcccctggacctcatgctggtggagacacccaagggg
gcactgtactccttcctcacggtgggctggggcatcatggccgacatcgacatcgagtca
gagcggctccgtgcaatcggggagatacgatttaccctctgggcattctggagggtcttc
aacctacgcacctaccagggccgcatctcctaccttcctgccacggtaccacccaagaac
ggcccgacggttgcggagacgccgctggcgccgccggacgggttcccgtcgctggacgat
ccggtgccggacgactggacggtggaagaggggcgcttcatcatcatctactcgagcctg
cagagccacctggggaccaacctgttctttgcgcctgaggcccggctggacgacggcgtg
gcctggctcctgatgatccgcggggatgcgacgaggctccagctgctcacctacttcaag
gcacaggaggagggccaccacgtggacctgccctacgttcggctgatccccgtgcgggca
ttcaggctcgaggcgttcgccaacagcacggtgaccgtggacggcgagctggtgcgcacc
aaggtgggtggcggctctc

DBGET integrated database retrieval system