KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW022811Help
Entry
IscW_ISCW022811   CDS       T01131                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase class, putative
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00562  Inositol phosphate metabolism
isc01100  Metabolic pathways
isc04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    IscW_ISCW022811
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    IscW_ISCW022811
Enzymes [BR:isc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     IscW_ISCW022811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka C2 PX PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 8040183
NCBI-ProteinID: XP_002414050
VectorBase: ISCW022811
UniProt: B7QET6
AA seq 1638 aa AA seqDB search
MAEGGREPRPPCLPPKTAAFNLGALDLGGGSSSTSTMYSFTQDSSMLRPPPLPPRRSVFS
DKCNGSGDLTSIPPAPTSAATWTSSDLLKLLHAPSGSDSRTSIKSIDALFLEDHSWKQQS
SSVTTTRTEHFQQRQQTWVSTHQQNHVFVGTEMTHSNSAPNFNALSSSAGVSPVHVHNLN
SALPSKLDIEKTMFSVLRKRPDSNLIDLSGDAELARKRESLRKSGDSLDDLLDLFDPLRE
FELTVEVEEKTHTSQSAAEAYRSEQTECKASAAPSRPPRHSPVSAQKRAQDSPPQETAHS
VEALRMQRHIHRMELLGSLTVERREVTHGDDIEAFWAKVKQLRSEFTYDDHHTNAGLVIS
PTLENKWEKHLSIKLEVTTSIADRPFCFTCDVGTSIEHIISNTICSLRDDLSDIALENYV
LKVKGLAEYLTPDSVLKEYEYVHQCYKFMKPVCLTLIDVRDLKKPWMRTLRDDSEFLEVK
TKALLSQPPGRVSFDSVSILMETFRKEAKKVQSSACSGCLQPNGAIQAVKAICATLSQIE
ILEIIHAIEGLKHICSQVPEADGSNDDFAASQEAGRGSVVTRERVAEVVFYSLLQLQSAL
RTLVTIYCRSFRVDFCLPPGEDGPVKKQQRPVTTFHDTFLFNAGSVHQLRPQWVAEYDQF
LLSCELRYGSRVMSVGETKKVKASRNLFELIVFDEWLEMKVFMRNLPREATLYMALYGIK
PSQENKSAEPQALDRVLLAWTSQALFSSRLELIQGSLFLGFWSSEVDEQSGPAQSNDAFS
CPILRVQFPEFESDVIFPQVARDDIVTCRASTYPLDSVMIQEISDILEKDPLSVPTTEDR
KFFWDHRHYTLEIPHLLPKVLLSAHSWSWPFLPDIYFLLTEWRPASPINALTLLLPLFPD
TQVRQTAVKWIKNIGSDELCDHLPQLIQALRFETWEDAPITWFLLERSLTSVRVAHQMFW
LLKQNMENPLTLKRMKLIVQTLLVIVGKSFREIIEKQEEHLNQLCIIAEGVKETRESLRL
DKLLQEMETIHNMMEESPSCLPLNPAMEVCGVDVKSCSYFTSNTLPLKVVYRSTEPGAKP
IEVIYKVGDDLRQDMLTLQMIRIMDKFWLKEGLDLKIITFTCVATGNRKGMVEMVTEAET
LRRIQTEHGLTGSFKDRPIAEWLQRHNTSELEYQQAVENFTYSCAGYCVATYILGICDRH
NDNIMLKTSGHMFHIDFGKFLGDSQMFVNFKRDRAPFVLTSDMVYVINGGEKPSKKFQVF
IDLCCQAFNIVRRNSNIFMTLFELMVTSGVPGVSTDAVNFVQKSLLLGSSEGEATAHFTR
LIEESLRSRFTQLNFFIHNIAQLRFTGDHNDGLLLSFVPRTFTKESDGRIVSLTVTGCHK
RYEPEKHYTYSVKITRESQTSSIHVFRTYAEFLELYQKLVRMFPLAKFYPLSKGSFVGRS
NTREVAERRKQDVEAFLLSLKKMAEEVSHCSLIYTFFHPLLRDQEGMAEDETLTDNLCQF
SKRVNLSQGIVGRIKLSIVYKAGSLSVMVMHAENLSCERKSSPDPYVKTYLLPDWDKSTK
KKTKVVFKNSHPSFMELLVYNFPLAVVRSRMLEVSAWDHDRVQENEFLGAAIIELSRMDL
STETTHWYHLNNVRYRWQ
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atggcagagggcggcagagagcctcggccaccgtgcctcccacccaagaccgcggccttc
aacctgggcgcactggacttgggaggcggaagctcgtccacgtccacaatgtactccttc
acccaagattcctccatgctgaggccacctcccctcccacctcgtcggagcgtcttctcc
gacaagtgcaacggatcgggggaccttacctccatccctccagctccaacgtcagctgca
acttggaccagttcggaccttctgaagcttctgcacgccccatcgggaagtgactcgcgg
acaagcatcaagtccattgatgcactcttcctcgaagaccattcctggaaacaacagtcg
tcgtctgtcaccactacccgcaccgagcatttccagcaacggcagcaaacctgggtcagc
actcaccagcagaatcacgtgtttgtcggcactgagatgacccacagcaattcggcaccc
aacttcaatgccctctcgtccagtgcaggcgtctccccagtccatgtacacaacctcaac
tcagcactgccttcaaaactggacattgaaaagacaatgttcagcgtgctacggaagagg
ccggacagcaacctcatcgacctgagtggagatgcagagttggcgaggaagagagagagt
ctccgcaagtctggcgactctctcgatgacctcttagacttgtttgacccattacgtgag
ttcgagcttaccgtcgaggttgaagaaaaaacgcacacttcgcagtctgcggctgaggct
tatagaagcgaacagacagagtgcaaggccagtgctgctccatcaaggccaccacggcac
agccctgtttctgcacagaaaagggctcaagacagtcctcctcaggaaacggcccattct
gtcgaagctctccgaatgcagagacacatacaccggatggaactccttggcagtctgaca
gtcgagaggcgagaagttacccatggcgacgacatcgaggctttctgggcgaaggtgaag
cagctgagaagcgaattcacctacgacgatcatcacaccaacgcaggcctcgtcatcagc
ccgaccctcgaaaacaagtgggaaaagcatctgagcatcaagctggaagtcacaacgtcc
atcgccgatcggccattttgcttcacatgcgacgtaggtacgagcatagagcacatcatc
agcaacaccatctgctccctgagggacgacctctctgacatcgccttggagaattacgtt
ttgaaagtgaagggccttgcggagtacctcacaccagattcagtcttgaaagagtatgag
tatgttcatcagtgctacaagttcatgaagccggtctgtctaactctgatagatgtccgc
gacctcaagaagccctggatgaggaccctgagagacgacagcgagtttttggaggtgaag
acgaaggccttgctctcgcagccacctggacgcgtttcctttgactctgtttcaatactg
atggaaaccttccgaaaggaagccaagaaggttcagtcttcggcgtgttccgggtgcttg
cagcctaatggtgcaatccaagccgtgaaggctatttgtgccacactctctcagattgaa
attctcgagattattcatgccattgaaggactgaagcacatctgcagtcaggtccccgag
gcagatggctcgaatgatgactttgctgcctctcaggaagccggccgaggttccgtcgta
acacgtgagcgagtggctgaagtagtgttttactcccttttgcaactgcagtcggcactt
cgtacccttgtcacaatttactgccgcagcttccgtgttgacttctgtcttccaccaggg
gaagacggcccagtaaagaagcaacagcgccctgtcaccacatttcacgacacctttctt
ttcaatgcgggaagtgtccatcaacttaggccccagtgggtcgccgagtatgaccagttc
ctactttcctgtgagcttcgttatggctcgcgcgtcatgtcggtgggcgagactaagaag
gtgaaggcaagtcgcaacttgtttgagctgattgtcttcgacgagtggcttgaaatgaag
gtgtttatgaggaaccttcctcgggaagcgaccctctacatggcactctacggcatcaag
ccctctcaggaaaacaagtctgcggagcctcaggcattggaccgtgtccttttggcctgg
actagtcaggcactcttcagcagccgactcgagctgatccaagggagcctctttctgggc
ttctggtcatcggaggttgacgagcagagtggccctgcccaaagcaacgatgccttttcc
tgtcccatcctccgcgttcagttcccagagtttgagtctgatgtcatctttccgcaagtg
gccagggatgacatcgttacttgcagggccagcacataccctctggacagcgtcatgatt
caagaaatctccgacatcctcgagaaggatcctctctctgtgccgactaccgaggatagg
aaattcttctgggaccaccgtcactatactcttgaaattcctcacctgcttcccaaggtt
cttctctcggcccacagctggagttggcctttcctcccggacatctactttctgctgacc
gagtggaggccagcgtcccccatcaatgcactcacactgctgcttcctctcttccctgac
acccaagtacgacagactgcggtgaagtggatcaagaacatcggcagcgatgagttgtgc
gaccacctcccgcagttgattcaagcactccggttcgagacgtgggaagatgcacccatc
acctggtttctcctggaacgttctctaaccagtgttcgtgttgcccaccagatgttctgg
ctgctcaagcagaacatggaaaaccctctgacgctcaagagaatgaagctcatcgttcag
acactcctggtcattgttggaaagtcctttagggagatcattgagaagcaggaagaacac
ctaaatcagctatgcatcatcgcagaaggggtgaaggagacgagggagtctctgcggttg
gacaagcttcttcaagagatggagaccattcacaacatgatggaagagagtccatcatgc
cttcctctgaatccagccatggaagtgtgtggtgtcgatgtcaagtcctgctcatacttt
acctccaacacccttccattgaaggttgtctacagaagcaccgagcctggagcaaagccg
atcgaagttatctacaaggtaggggacgaccttcgccaagacatgcttactcttcagatg
attcgtatcatggacaagttctggctgaaggaagggctcgacctcaagattattacgttc
acgtgtgtcgccactggaaacaggaagggtatggtagagatggtcacagaagccgagacg
ctgaggagaatccaaaccgaacacggtctcacgggctctttcaaagaccgccccattgcg
gagtggctgcagcgacacaacacttcggaactggagtatcaacaggcggtagaaaacttc
acctactcatgtgccggttactgcgtcgccacctacatcctcggcatctgcgatcggcac
aacgacaatatcatgctgaaaacctccggacacatgtttcacattgactttggaaagttc
ctcggtgattcacagatgtttgtcaacttcaagcgtgacagggccccattcgtacttact
tccgacatggtgtatgtgatcaacggaggcgagaaacccagcaagaagtttcaggtgttc
atcgacctgtgttgtcaggcattcaacattgttcgtcgtaacagcaacatatttatgacc
ctcttcgagctgatggtgacttcgggtgttcccggggtaagcaccgacgccgtaaacttt
gtgcaaaagtcgctcctcctgggcagttcggaaggtgaggccactgctcattttacacgg
ctcattgaggagagccttcggtcgcgcttcacccagctcaacttcttcatccacaacatc
gcccagcttcgcttcaccggtgaccacaacgatggactcctgctctctttcgtgccccgc
acgttcaccaaggagtccgatgggaggatcgtgtccctgacagtcactggctgccacaaa
cgctacgaacccgagaagcattacacttactccgtaaagatcacgcgggagtcccagaca
tcctccattcatgtcttccggacatacgcggagttcctcgagctctaccagaagctggtg
agaatgttcccccttgccaagttctatccactgtccaaggggtccttcgtagggcgcagc
aacacgcgtgaggtggccgaacgtcggaagcaagacgtcgaggccttcctcttgtccttg
aagaagatggccgaagaggtgtcacactgcagtctcatctacaccttcttccacccgctc
ctgagggaccaagaagggatggcggaggacgagacgctcaccgacaacttgtgccagttt
agcaagcgtgtcaacctgtcgcaggggattgtgggtcgcatcaagctgtccatcgtctac
aaggccggcagcctgtccgtcatggtgatgcacgccgagaacctttcgtgcgagcgcaag
tcgtcacccgacccgtacgtcaagacgtaccttctgccagactgggacaagtcgaccaag
aagaagacgaaagtggtcttcaagaacagtcaccccagcttcatggagctgttggtgtac
aactttccgctggccgtcgtgcgtagcaggatgcttgaggtgtcggcgtgggaccacgac
agggtccaggagaacgagttccttggcgcagccatcattgaactgtccaggatggatctg
tccacagagaccactcactggtatcatctgaacaatgttcgctaccggtggcagtga

DBGET integrated database retrieval system