KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023345Help
Entry
IscW_ISCW023345   CDS       T01131                                 

Definition
(GenBank) carnitine palmitoyltransferase II, putative
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00071  Fatty acid degradation
isc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IscW_ISCW023345
Enzymes [BR:isc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     IscW_ISCW023345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-ProteinID: EEC19417
VectorBase: ISCW023345
UniProt: B7QKP5
AA seq 634 aa AA seqDB search
CRGPDVNSPQYQFLQQSVVPTMHFQKSLPRLPIPNLEKTCERYLSALEPLVSVGELQSSR
RLVQEFKDKDGPELDKLLRARDKANKHTSYISGPWFDMYLSSRKPLPLNFNPFLALKDDP
RPEYNQQVVRASNMVVSSLRFLRSLRSNQLEPVVFHLNPDKSDTAFYRRTMRFLPEAVAW
YGSALAWKAYPLDMSQFGNLFGSTRVPQLGRDKLVADGKSRHLLVMRNGHCYSVQALDEQ
GNLFAPEHYRACLEHILADPRPPPAVAVPALTAGPRDNWARARQALEGAGNGQTLRRLDS
ALFALVLDQETFPGTSQEEKIAHHFLHGPVHNRWFDKSFSLLLTGDGHAAVNFEHAWGDG
VAVLRYFNDLFTDSTEQPRVHPGSAPSTDAGQFVERLDFKVNDSVAEAVKQAVNGYKEAT
GSLQLSALKHAGLSRDLIKSSGLSPDSVAQLSFQLAYHLEHGTTPATYESCSTSAFRHGR
TETVRPATMATKRCMEALSSGTSPQRARPLLEECSRVHSKLTKEAAMGQGFDRHLFALRL
LAEERGGPMPSLFGDPCFVKANHFCLSTSTLHGTAFSGGGFAPVVPDGYGLGYGMVDGCF
GVLTSAYAPHRDASRFASALTEALNRICAAMAAR
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
tgcaggggaccggacgtcaactccccgcagtatcagttcctgcagcagagcgtggtcccg
acaatgcacttccagaagagcctacctcgcctgcccatcccaaacctggagaagacgtgc
gaacggtatctgagcgcgctggagcccctggtgagcgtgggtgagctgcagtcctcccga
cggctagtgcaagagttcaaggacaaggacggcccggagctggacaagctcctcagggca
agggacaaggcaaacaagcacaccagctacatctctggtccctggtttgacatgtacctg
agttctcgcaagcccctacccctcaacttcaacccattcctggcactcaaggatgacccg
cggccagaatacaaccagcaggtggtgcgagcaagcaacatggtggtgtcgtcgctacgt
ttcctgcgctcgcttcggtctaaccagctggaacctgtggtcttccacctcaaccccgac
aagagcgacactgccttttaccgacgaactatgaggtttctccccgaggctgtggcctgg
tacggcagcgcccttgcctggaaggcctaccctctggacatgagtcagttcggaaacctg
tttggcagcacccgcgtaccgcagctcgggcgggacaagcttgtggccgacgggaagtcc
aggcacctgctcgtgatgcgcaacggccactgttactctgtgcaggccctcgacgagcag
ggcaatctgtttgccccagaacactaccgggcctgcctggagcacatcctggcagatccg
aggccccctccggcggtggctgtgcccgccctcacggcggggccccgggacaactgggca
cgggcacggcaggcgctcgagggcgctggcaacgggcagacgctgcgccgcctcgacagc
gccctttttgccctggtgctggaccaggagacgttccccggcacatcccaggaggagaag
attgcacaccacttcctgcacggcccagttcacaaccggtggtttgacaagtccttctcg
ctgctcctgaccggcgacgggcatgcggccgtgaactttgagcatgcctggggagacggg
gtggctgtgctgcgctacttcaacgacctgttcaccgactccaccgagcagcctcgagtg
catccgggcagcgcaccaagcacagacgccgggcagtttgtggagcggctggacttcaag
gtgaacgacagtgtggccgaagcggtaaagcaggcggtgaacggctacaaggaagccacg
ggaagtctgcagctgtcagctttgaagcacgccggcctgagcagggacctcatcaagagc
agtggcctcagccccgactctgtggcgcagctctctttccagcttgcctatcacctggag
catggaacgacgccggcgacgtatgaatcttgcagcacctcagccttccggcacgggcgc
acggagacggtgcgcccagccaccatggccaccaagcggtgtatggaggcactcagctct
ggcacgtcaccgcagcgggccaggcccctcctcgaggagtgctcgcgtgtgcacagcaag
cttacgaaagaggcagccatgggtcaggggtttgaccggcacctgttcgccctgcggcta
ctggcagaagagcgaggtggccccatgcccagtctcttcggagacccctgcttcgtcaag
gccaaccacttctgcctgtccacatccaccctgcacggaactgccttcagcggcggcgga
ttcgcccccgtggtgccggatggctacggcttgggctacggcatggtggatggctgtttt
ggagtgctgacgagcgcctacgctcctcatcgagatgcaagccgctttgcgagtgctctc
acggaggccctaaaccgcatctgcgcggccatggccgctcgctag

DBGET integrated database retrieval system