KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023712Help
Entry
IscW_ISCW023712   CDS       T01131                                 

Definition
(GenBank) beta-ketoacyl-ACP reductase, putative
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00061  Fatty acid biosynthesis
isc01100  Metabolic pathways
isc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    IscW_ISCW023712
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     IscW_ISCW023712
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     IscW_ISCW023712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase AdoHcyase_NAD NAD_binding_3 3Beta_HSD RsgA_GTPase THF_DHG_CYH_C AAA_28 3HCDH_N NAD_binding_7 AAA_24
Motif
Other DBs
NCBI-ProteinID: EEC18422
VectorBase: ISCW023712
UniProt: B7QHV0
AA seq 132 aa AA seqDB search
LTDTTMSFCLPFAGQTAVVIGGGSGIGKSTCNALASEGALVVVADISLETARTTAQSLPE
ISQHLAIQVDVGSSQSVKALFETVGRECKVPPSIVVNCAGIMGARRYLTETPEDDFDNVV
RVNLKVINFLYI
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
ctcactgacaccacgatgagcttctgtctgccttttgccggccaaaccgctgtagtcata
ggaggaggtagcggtattgggaagtcaacgtgcaacgcgcttgcgagcgaaggggcactg
gtcgttgtggcggacatcagcttggaaactgcgagaaccacggcccagtctctgcctgag
atatctcagcacttggccatccaggtagacgttgggtcctcgcagtcggtgaaggcgctc
ttcgaaactgtcgggcgggagtgcaaagttcccccgagcatcgtggtgaactgcgcaggc
atcatgggtgcgaggcgctatttgacagagacacctgaagacgacttcgacaacgttgtt
cgagtaaatcttaaggttattaactttttatatatttag

DBGET integrated database retrieval system