KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023765Help
Entry
IscW_ISCW023765   CDS       T01131                                 

Definition
(GenBank) methionyl-tRNA synthetase, putative
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00450  Selenocompound metabolism
isc00970  Aminoacyl-tRNA biosynthesis
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    IscW_ISCW023765
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    IscW_ISCW023765
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:isc01007]
    IscW_ISCW023765
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:isc03016]
    IscW_ISCW023765
Enzymes [BR:isc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     IscW_ISCW023765
Amino acid related enzymes [BR:isc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   IscW_ISCW023765
Transfer RNA biogenesis [BR:isc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    IscW_ISCW023765
 Prokaryotic type
   Other AARSs
    IscW_ISCW023765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: EEC19093
VectorBase: ISCW023765
UniProt: B7QJS1
AA seq 522 aa AA seqDB search
MGSCRYFITTPIFYVNAGPHLGHHHTVVLADSLHRLHRLLAPSSPTIFSTGTDEHGLKIQ
QAASKAKQDELSFCNRISKQFKDLFDSTSITYTDYVRTTEERHKACVRHFWEVLQKKEHI
YTGTYKGWYSTQEELFLSDSEIKEVPKEDGTPQKVSIESGHPVEWMEEKNYVFRLSRFQD
DLIHWLKSPGVVKPAKFQDLLVHWIRAGLQDLSVSRQSSRVKWGIMVPGDETQTIYVWLD
ALVNYLTVSGYPGPNHSWPPDCHVIGKDILKFHGIYWPAFLIAAGLEPPRSILCHSHWTV
NNEKMSKSKGNVLCPVKKVDKYTADGIRYFLLREGVPHSDGNFNSVKVQRLLNAELADTL
GNLLSRCTAPLVNKQQIFPAYNSKSFEELPDGQKVLVELQGLPDKVKARYLEGNIYQGLD
EVMHVLRRTNAVVQDAKPWELAKSPDAGHRLDAVLHMALEVLRVSAIVLQPVIPVLSTRI
LDKLQVGGDERTWSCAETPDVRQRPLTTDKTHVFSRLRTASA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgggttcttgccggtattttatcactaccccgatattctacgtcaatgccggcccacac
ctcggccatcatcacactgtggttctagctgattcgctgcacagactacacaggctgctt
gctccgagtagccctacaatattttctacaggcacagatgaacatggtctgaagatacag
caagctgcttctaaagccaaacaagatgaactgtctttctgtaacagaatatcaaaacag
ttcaaggacctcttcgacagcactagcatcacatacaccgactatgttcgaacaacagaa
gaaaggcataaagcatgtgtcagacatttttgggaagtgctgcagaagaaagagcacata
tacactggtacatacaagggatggtattcaacccaagaagagctatttctctctgattct
gagatcaaagaggttccaaaagaagatggaactccacaaaaagtaagcatagagtctggc
caccctgtagaatggatggaagagaagaactatgtcttccgcctttcccggtttcaagat
gacttaattcattggctgaaatccccaggtgttgtcaagccagccaagttccaagacctc
ctggtgcactggattagggcaggactccaagacctgtctgtatccagacagagctcacgt
gtcaagtggggcatcatggttcctggggatgagacacagactatctatgtatggctcgac
gctctagtcaactacctcactgtcagtggttatccaggcccaaaccacagttggcctcca
gactgccatgttatcggaaaggacatcttaaaatttcatggcatctactggccggctttc
ttaatagcagctgggctggagccaccacggagtatcctctgtcactcacattggacagtt
aacaacgaaaagatgtcgaaaagcaagggcaatgtcttgtgtcctgtgaagaaagtggac
aagtacactgctgacggcatccggtactttctactcagagaaggtgttccacattcggat
ggcaatttcaacagtgtcaaagttcagcgactgctgaatgccgaactggctgacaccctt
ggaaatctgctaagcagatgcacggcccccctggtgaacaagcagcaaatattccctgcc
tacaacagcaagagctttgaagagttgccagatggtcagaaagtcctcgtggaactgcaa
ggtcttcctgacaaagtgaaggcaaggtaccttgaaggcaacatctaccaaggcctcgac
gaggtgatgcacgttctgcggcggacgaacgccgtcgttcaagatgccaaaccctgggag
ctggccaagtctccggatgctggacatcgtttggatgctgtgttgcacatggccctcgaa
gtgctcagggtgtccgccatcgttctgcagcccgtgattccggtgctttcgacaaggatc
ctggacaagctgcaagtcggcggcgacgaacgaacgtggtcctgcgccgagactcccgac
gtccgacagaggccgctcacgacagacaagacgcacgtgttttctaggcttcgaactgcg
agcgcgtaa

DBGET integrated database retrieval system