KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW023977Help
Entry
IscW_ISCW023977   CDS       T01131                                 

Definition
(GenBank) guanylate cyclase C, putative
Organism
isc  Ixodes scapularis (black-legged tick)
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA MitMem_reg
Motif
Other DBs
NCBI-ProteinID: EEC20246
VectorBase: ISCW023977
UniProt: B7QN24
AA seq 364 aa AA seqDB search
KLWTAPELLRAQEPPVNGTQKGDVYSFAIISHEIAVRQGAFYLGNIDMSPKEVVEQVMSE
SKPLFRPVFDEMDCPDEVRLLITKCWAGDPAERPDFQTLKSLIRKLNKESESGNILDNLL
SRMEQYANNLESLVEERTSDYLEEKRKAEDLLYQLLPRSVASQLIKGQSVRAESYDIVTI
YFSDIVGFTSLSAQSTPMQVVDLLNDLYTCFDSVIENFDVYKVETIGDAYMVVSGIPVRN
GIMNAREIARMSLALLKQVLSFKIRHRPGEKLNLRIGIHTGPCAAGVVGLKMPRYCLFGD
TVNTASRMESNGMPLRIHVSTPTKEVLDTFKTFQLELRGEVEMKGKGKMTTYWLLGEQEP
DASA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
aaattatggactgcgccagaattgctgcgcgcccaggagccgccagttaacggcacacag
aagggtgatgtgtattctttcgccattatctctcacgagatcgccgttcgtcaaggcgcg
ttttacttgggcaacatcgacatgagtccaaaagaggtcgtggagcaggttatgtccgag
tcgaagcccctgttcaggccggtcttcgacgagatggactgccccgacgaggtccgactc
ctgatcaccaagtgctgggctggagatcccgccgagaggcccgacttccagacactcaag
tccctcataaggaagctcaacaaagaatccgagagtggcaacatcctggacaaccttctg
tctcggatggaacagtacgccaacaatttggagtctctggtcgaggagcgaacatctgac
tacctcgaggagaaacgcaaagctgaggatctcctttatcaacttcttcccagatctgta
gcgagtcagttaatcaagggccaatcagtacgagcggaatcgtacgacatcgtcaccata
tacttcagtgatatcgtcggcttcacatcactttccgcacaaagtactcctatgcaggtg
gtggatttgctcaacgatctctacacctgcttcgattctgtaattgagaacttcgacgta
tacaaggttgagaccatcggcgacgcctacatggtcgtgtccgggattcccgtgcgcaac
ggtatcatgaacgcccgggagatagcgcggatgtccctggcgctcctcaagcaggtcctc
tccttcaagatccgacatcgaccgggagagaagctcaatctacgcatcggcatccacacg
ggtccatgtgcggccggcgtcgtcgggctcaaaatgccccgctactgcctcttcggagac
actgtcaacacggcatcgaggatggagtctaacggaatgcctttgagaattcacgtgagc
actcccaccaaagaggtattagacacctttaagacgtttcagctggaacttcgaggagaa
gtagaaatgaagggcaaaggaaaaatgaccacttactggctcctcggagagcaagaaccc
gatgccagtgct

DBGET integrated database retrieval system