KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW024057Help
Entry
IscW_ISCW024057   CDS       T01131                                 

Definition
(GenBank) heat shock protein 70, putative
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc03040  Spliceosome
isc04141  Protein processing in endoplasmic reticulum
isc04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:isc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    IscW_ISCW024057
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    IscW_ISCW024057
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    IscW_ISCW024057
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:isc01009]
    IscW_ISCW024057
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:isc03041]
    IscW_ISCW024057
   03009 Ribosome biogenesis [BR:isc03009]
    IscW_ISCW024057
   03110 Chaperones and folding catalysts [BR:isc03110]
    IscW_ISCW024057
   04131 Membrane trafficking [BR:isc04131]
    IscW_ISCW024057
   03051 Proteasome [BR:isc03051]
    IscW_ISCW024057
   03029 Mitochondrial biogenesis [BR:isc03029]
    IscW_ISCW024057
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW024057
Protein phosphatases and associated proteins [BR:isc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     IscW_ISCW024057
Spliceosome [BR:isc03041]
 Complex B
  Other components
   Prp19 complex
    IscW_ISCW024057
 Complex C
   Prp19-CDC5 complex
    IscW_ISCW024057
Ribosome biogenesis [BR:isc03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    IscW_ISCW024057
Chaperones and folding catalysts [BR:isc03110]
 Heat shock proteins
  HSP70 / DNAK
   IscW_ISCW024057
Membrane trafficking [BR:isc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    IscW_ISCW024057
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    IscW_ISCW024057
Proteasome [BR:isc03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    IscW_ISCW024057
Mitochondrial biogenesis [BR:isc03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    IscW_ISCW024057
Exosome [BR:isc04147]
 Exosomal proteins
  Proteins found in most exosomes
   IscW_ISCW024057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A
Motif
Other DBs
NCBI-ProteinID: EEC01647
VectorBase: ISCW024057
UniProt: B7P4X5
AA seq 212 aa AA seqDB search
MASRTNRRAPAIGIDLGTTHSCVGVFQHGRVEIIANEQGNRTTPSYVAFTDTERLIGDAA
MAQTARNTENTVFDVKRLIGRKFGDPKIQDDLKHWPFKVENDAGKPKISVELKGERKRFH
PEEISAMVLAKMKETAEAFLGRKVSDAVVTVPACFNNSQRQATKDAGVIAGLNVLRIINE
PTAAALAYGLDKNLKGEKNVLIFDLGGGTFDV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcgaacgaacaggagagcgccggccatcggcatcgacttgggtaccacgcac
tcctgcgtcggtgtgttccagcacggtcgtgtcgaaatcatcgccaacgagcagggcaac
cgaacgacgccaagttacgtcgccttcaccgacaccgagcgactcatcggagacgcagcg
atggcccagactgcgcggaacacggagaacacagtgttcgatgtcaaaaggctcatcgga
cgaaagttcggtgatcctaagatccaggatgatctcaagcactggcccttcaaggtggag
aacgacgctggcaagcccaagatcagcgtggagctcaagggagagcggaagaggttccac
ccggaggagatcagtgccatggtgctggccaagatgaaggaaactgcggaggccttcctt
ggtcggaaggtcagcgacgctgtggtcacggtgcctgcttgcttcaacaattctcagagg
caggctacgaaagacgccggagttatcgccggtctcaatgtgctccggatcatcaacgag
cccaccgcagctgcactggcctacggactcgacaagaacctcaagggagagaagaacgtc
ctcatcttcgatctggggggaggaactttcgatgtg

DBGET integrated database retrieval system