KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW024516Help
Entry
IscW_ISCW024516   CDS       T01131                                 

Definition
(RefSeq) abhydrolase domain-containing protein, putative
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
isc  Ixodes scapularis (black-legged tick)
Brite
KEGG Orthology (KO) [BR:isc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:isc01002]
    IscW_ISCW024516
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:isc04147]
    IscW_ISCW024516
Enzymes [BR:isc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     IscW_ISCW024516
Peptidases [BR:isc01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   IscW_ISCW024516
Exosome [BR:isc04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   IscW_ISCW024516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 Abhydrolase_3 Lipase_3 Abhydrolase_4 Lipase Cutinase Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 8032790
NCBI-ProteinID: XP_002400570
VectorBase: ISCW024516
UniProt: B7PXG1
AA seq 298 aa AA seqDB search
QEVLIFGHYINWPPLINFNDTDAYELPYTRSLFIESADNIALGTWHVMPKSEWHRCANGV
HPDAEFQDSRPVIIYYHGHAETRATDYRVQLYRRLSQSIVDAHVIAFDYRGFGDSTNVMP
SRHGVIQDSLAVYEWVKRKVPNSRIVIWGHSLGTGVAIQLGEIFARTGDNPAAIVLEAPF
NSLVEAALRWPLSIPFRYIPGTRKILEPLLEEDTNFESEQKAGTLTAPVLVLHSKDDPLV
PYDLGRKLYERLQRDRPSHLPAAVFYDVDSSVGPGHRRIYKDPKFPEVVSGFIKSVVR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
caggaggtcctcatcttcggtcactacatcaactggccgccactcatcaacttcaacgac
acggacgcttacgaactcccctacactcgctccctcttcatcgagtcagccgacaacatc
gccctgggcacctggcacgtcatgccaaagagcgagtggcaccgttgtgcaaatggggtg
catcctgatgccgagttccaggacagcagaccggtcatcatctactaccacggacacgcc
gaaactcgtgcgacagactaccgagttcagctgtacaggcggctttcgcagagcatcgtt
gatgcccatgtcatcgccttcgactaccgtggctttggcgactccacgaatgtgatgcct
tcgcggcatggcgttatccaggactcattggccgtctacgagtgggtcaagcgtaaggtt
ccgaactcgaggatcgtcatctggggacattcccttgggaccggggttgccatccagctt
ggtgagatctttgcaagaacgggagacaacccagcggccattgtcctcgaagcgcctttc
aacagcctggtggaagctgcactgcggtggcctctgagcatcccgtttcgctacataccc
ggcacacggaagatcctggagcctctgctggaagaggacaccaactttgagtcggagcag
aaggccggaaccctgactgctccagtactggtcctgcattccaaggatgatcctctggtg
ccctacgacctcgggaggaagttgtacgaaaggttgcagcgggaccgcccttcccatctt
ccagctgccgttttctacgacgttgacagcagcgtgggtcccggacaccgtcggatctac
aaggatccaaagttccctgaggtggtgtctgggtttattaagagcgttgtgagatga

DBGET integrated database retrieval system