KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW024631Help
Entry
IscW_ISCW024631   CDS       T01131                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, putative
  KO
K13247  L-gulonate 3-dehydrogenase [EC:1.1.1.45]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
isc00040  Pentose and glucuronate interconversions
isc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    IscW_ISCW024631
Enzymes [BR:isc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.45  L-gulonate 3-dehydrogenase
     IscW_ISCW024631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N 3HCDH UBA_e1_thiolCys NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: EEC15098
VectorBase: ISCW024631
UniProt: B7Q8C6
AA seq 193 aa AA seqDB search
MLFASVGYKVALFDVEPRKIDEALKDIEDQVETLEKNGALRGNLTAKQQYQLVQRSASMA
DCIEGAIHVQECVFENLELKQKVFLEMDKLADDKVVLCSSTSCFPPSSFTRDLKHRSQAI
VGHPVNPPYYVPLVEVVPAPWTDPLIVIRTRALMKEIGQKPVVLKKEVDGFVLNRIQYTV
LNECWRLIQVTVP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgccagtgtgggctacaaggttgcactctttgacgtggagccacgcaaaatc
gatgaggcactgaaggacatcgaggatcaagtcgaaacactagaaaaaaatggggctctg
cgaggcaaccttactgccaaacagcagtatcaacttgttcaaaggagtgcttcaatggca
gactgtatcgagggggccatccacgtgcaggaatgcgtctttgagaacttggagctcaaa
caaaaagtgttcctcgagatggacaagcttgcagacgacaaagtggttctttgcagctcc
acgagctgctttccaccttcgagctttaccagggatcttaaacataggagtcaagccatt
gtgggtcaccctgtcaatccaccatactacgtcccacttgtggaagtcgtcccagccccc
tggacagaccccctgattgttattcgaactcgtgctctcatgaaagaaattggccagaag
ccagttgtcctcaagaaagaagtggatggctttgtgctcaacaggattcagtacaccgta
ctcaatgaatgctggaggctcattcaggtaactgtaccttaa

DBGET integrated database retrieval system