KEGG   Ichthyobacterium seriolicida: JBKA6_0268Help
Entry
JBKA6_0268        CDS       T05228                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ise  Ichthyobacterium seriolicida
Pathway
ise00020  Citrate cycle (TCA cycle)
ise00310  Lysine degradation
ise00380  Tryptophan metabolism
ise01100  Metabolic pathways
ise01110  Biosynthesis of secondary metabolites
ise01120  Microbial metabolism in diverse environments
ise01130  Biosynthesis of antibiotics
ise01200  Carbon metabolism
Module
ise_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ise_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ise00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JBKA6_0268
  09105 Amino acid metabolism
   00310 Lysine degradation
    JBKA6_0268
   00380 Tryptophan metabolism
    JBKA6_0268
Enzymes [BR:ise01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     JBKA6_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: BAV94281
UniProt: A0A1J1DWN4
Position
complement(354082..355278)
Genome map
AA seq 398 aa AA seqDB search
MVEIKIPSPGESISEVEIASWLVQNGDYVEKEQTIAEIDSDKATLELPAECSGVIHIKVE
EGNTVKVGEVVCHIDTTASKPDKAESVKNTKPTVETPVMECNSPKKESYATGTPSPSAKK
MMEEVGVSKVDGSGRDGRIIKEDVVKAVAAMGSNPIGNRGASRKKMSLLRKKISQRLVSV
KNETAMLSTFNEVDMSAVMSLREKYKDRFNEKHGVKLGFMSFFTKAVVRSLGLYPDVGSM
IDGDEQITYAYSDISIAVSTPKGLMVPVLRNAETMSFKAIELEIKKLSIKAREGKLSLDD
MIGGNFSITNGGVFGSMLSTPIINPPQSAILGMHNIVDRPVVVNGNIEIRPIMYVALSYD
HRIIDGSQSVSFLVELKKAIENPTELLMDGREELSLEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggtagaaattaagatacctagtccaggtgagtcaatatcggaagtagaaatagcatct
tggctagttcaaaatggagattatgtagaaaaagagcaaaccatagctgagatagattca
gataaagctactttagagctacctgctgaatgtagtggtgtgattcacataaaagtggag
gaaggaaatactgtaaaagttggagaagtggtttgtcatatagacaccacagcttcaaaa
ccagacaaagcagaatcagttaaaaacacaaaaccaacagtagagactcctgtaatggaa
tgtaattctcctaaaaaagaatcttatgctacgggaacaccttctccatctgctaaaaaa
atgatggaagaggtgggagtgtcaaaagtagatggatctggaagagatggcagaataata
aaagaagacgtcgtaaaagccgtagctgctatgggatcaaaccctattggcaacagaggg
gcatctagaaagaaaatgtctctgctcaggaaaaagatatctcaaaggctcgtgtcagta
aaaaacgagactgctatgctgtctactttcaatgaagtagatatgagcgctgtgatgtct
ctaagagaaaaatacaaagatagattcaatgaaaaacacggtgtgaagttgggctttatg
tcttttttcaccaaggctgttgtgaggagtttagggttatatcctgatgttggatctatg
atagatggcgatgaacagataacttatgcttattcagatataagtatagccgtatcaact
cctaagggattgatggttcctgtcttaaggaatgccgaaactatgtcttttaaagctata
gagttagaaataaagaaattatctataaaggctagagaaggaaaattgtctttggacgat
atgataggaggtaatttttcaattacaaacggcggggtatttggatctatgttatccact
cctattataaatcctcctcaaagcgctattttgggtatgcataatatagtcgatcgtcca
gtagttgtaaatggaaatatagagattcgtcctataatgtatgtagcactatcttatgat
cacagaattatagatggaagtcagtctgtcagtttcttagtcgagcttaagaaagctata
gaaaaccctacagagctacttatggatggcagagaagaattatccttagaattataa

DBGET integrated database retrieval system