KEGG   Ichthyobacterium seriolicida: JBKA6_0314Help
Entry
JBKA6_0314        CDS       T05228                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ise  Ichthyobacterium seriolicida
Pathway
ise00900  Terpenoid backbone biosynthesis
ise01110  Biosynthesis of secondary metabolites
ise01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ise00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JBKA6_0314
Enzymes [BR:ise01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     JBKA6_0314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: BAV94327
UniProt: A0A1J1DWU3
Position
complement(421048..422364)
Genome map
AA seq 438 aa AA seqDB search
MKKHTKGFSKLSKSEKIDFLYTECLNSSEKDLEVLNSHMYGDVNIQKLYDEFSENTVSNF
YMPFGIAPNFLINDKLYTIPMVIEESSVVASASKTANFWLDKGGFKAEVLSTEKIGHVHF
IYRGDGDKLRKFFRLELKEKLLDSVSHLTEAMRSRGGGIMDINLIDKSLEEENYFQIEAT
FQTVDSMGANFINSCLELFAEKLKNIISQADHFSSEEKDLEVIMSILSNYTPKCIVRAHV
ECRVEELTDSIGSSDFADKFVKAVRIAKAEPYRATTHNKGIFNGIDAVVIATGNDFRAVE
ACGHSYASRNGKYTSLSDVSIENGIFRFWLDLPISVGTVGGLTDLHPMAKLSHKILGNPN
AKELMCIIAVAGLAQNFAALRALVTTGIQKGHMKVHLLNILNRLGATDKEKVYFVDYFKD
KTVSHYEVVKLFNSVKAV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacacacaaagggtttttcaaaattatctaagtctgaaaagatagacttctta
tataccgagtgtttaaattcttctgagaaagacttggaagtattgaatagtcacatgtac
ggtgatgtaaatattcagaaattgtacgatgagttctctgagaatacagtttctaatttc
tatatgccctttggcatcgcccccaattttttaataaacgacaagctgtataccatccct
atggtaatagaagagagttctgtggtcgcttcagcatctaaaaccgctaatttctggttg
gacaaaggaggttttaaggcagaggttctctctactgaaaagataggccatgttcatttt
atctatagaggagatggtgataagctcagaaaattttttcgtttagaattaaaagagaaa
ttgttagatagtgtttcacatctgacagaagccatgaggtctagaggtggcggaattatg
gatatcaatctgatagacaagagtttagaagaagaaaattattttcagatagaagctact
tttcaaacagttgattctatgggagctaactttataaattcttgtttagaactatttgct
gagaagttaaaaaatatcatctcccaagcagatcatttttcctctgaagaaaaagactta
gaggtaataatgtcaatattgtctaattatacaccaaaatgtattgttagggctcatgta
gaatgcagagtagaagagttgacagatagtataggatcatctgattttgcagataaattt
gtaaaagcagtcagaatagctaaagcagagccttatagagctactactcataacaaggga
atcttcaacggtatagatgctgtggtaatagctacgggaaatgactttagggctgtagag
gcttgtgggcattcctatgcctctagaaatggaaaatatactagtctcagtgatgtaagt
atagaaaatggcatttttcgtttttggttggatttgcccatatctgtcggcacagtagga
ggcttaaccgatttacatcccatggcaaaattatcacataagattttaggtaatccaaat
gccaaagaattgatgtgtattatagcagttgcgggtttagcgcaaaattttgccgctttg
agagctctggtaactactggaattcaaaaagggcatatgaaggttcaccttttaaacata
ttgaataggctaggagctacagataaagaaaaagtttattttgtagactattttaaggat
aagaccgtatcccattatgaggttgtgaaactttttaacagtgtaaaggcggtataa

DBGET integrated database retrieval system