KEGG   Ichthyobacterium seriolicida: JBKA6_0365Help
Entry
JBKA6_0365        CDS       T05228                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ise  Ichthyobacterium seriolicida
Pathway
ise00860  Porphyrin and chlorophyll metabolism
ise01100  Metabolic pathways
ise01110  Biosynthesis of secondary metabolites
ise01120  Microbial metabolism in diverse environments
Module
ise_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ise00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JBKA6_0365
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ise01007]
    JBKA6_0365
Enzymes [BR:ise01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     JBKA6_0365
Amino acid related enzymes [BR:ise01007]
 Aminotransferase (transaminase)
  Class III
   JBKA6_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase Ligase_CoA
Motif
Other DBs
NCBI-ProteinID: BAV94378
UniProt: A0A1J1DWZ3
Position
479380..480657
Genome map
AA seq 425 aa AA seqDB search
MHTKSNNLFKEAKRFIPGGVNSPVRAFKGVGGKPVFIRRAKGAHLYDEDGNVYIDYINSW
GPMILGHASESVINAITEQVRRGTSFGTPTEIEVEIAKLIIEMCPFIDMIRMVNSGTEAC
MSAIRLARAYTNRDKFIKFEGCYHGHSDSFLIKAGSGAMTFGTPSSPGVTSSTSKDTLLA
TYNDIGSVKRLIEEYKNQIAAIILEPVAGNMGCIPPVDNFLSQLRELCDQNNIVLIFDEV
MTGFRLSKGGAQEFFGVKADLVTYGKIIGGGMPVGAFAGKSEIMNCVSPVGDVYQAGTLS
GNPMAMIAGYTVLKELSDNPDIYKNINEKTAKLESEFISILSRKDIPFRINRVGSMISIF
FCEEEVESFNSANTVDTKVFNKFFHHMLSNGVYLPPSAFETWFICNELSNTDIEKTVEAV
DSFSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcatactaaaagcaataacctttttaaagaagctaaaagatttatacctggtggggta
aattctcctgtgagagcttttaaaggtgtaggaggcaagcctgtttttataagaagggca
aagggggctcatctctatgatgaagatggaaatgtctatatagattatataaattcttgg
ggccctatgattttgggtcacgctagtgaatcagttataaacgctattaccgaacaagtt
aggagaggaacatcatttggaactccaacagagatagaagtcgagatagccaagttgata
atagagatgtgtccttttatagatatgatacgaatggtcaattcgggcacggaagcttgt
atgagtgctattcgtttggcaagagcttatacaaacagggataagtttataaaatttgaa
ggttgttatcacgggcattcagactcttttttaattaaggctggcagtggagccatgact
tttggaactccaagtagtccaggtgttacatcgtctacatctaaagatactttattagct
acttataatgatataggaagtgtaaagaggttaatagaggaatataaaaatcaaatagcg
gctattattttggagccagtggctgggaatatgggatgtattcctccagttgataatttt
ttaagtcagcttagggaattgtgtgatcaaaacaatatagtcttgatttttgatgaagta
atgacaggttttagattgtctaaagggggagctcaggagttttttggagtcaaagcagat
ttggtaacctacggaaagattataggaggcggtatgcctgttggtgcttttgcaggcaaa
tcagaaataatgaattgtgtttctcctgttggagatgtttatcaagctggcactctatct
gggaaccctatggctatgatagccggatatactgttttaaaggagttgtcagacaatcca
gatatatataaaaacataaatgaaaagacagctaaacttgagagtgagtttataagtatt
ctatctagaaaagatattccttttaggataaacagagtgggatctatgattagtatattc
ttctgtgaagaagaagtagaaagctttaattctgctaacacggttgacactaaagttttt
aataagttttttcatcatatgttgtccaatggtgtgtatttgcctccttctgcttttgag
acctggtttatatgcaatgaattgtccaatacagatatagaaaaaactgtagaagcagtt
gatagtttttctctttaa

DBGET integrated database retrieval system