KEGG   Isoptericola variabilis: Isova_0381Help
Entry
Isova_0381        CDS       T01520                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
iva  Isoptericola variabilis
Pathway
iva00010  Glycolysis / Gluconeogenesis
iva00620  Pyruvate metabolism
iva00640  Propanoate metabolism
iva00680  Methane metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Isova_0381
   00620 Pyruvate metabolism
    Isova_0381
   00640 Propanoate metabolism
    Isova_0381
  Energy metabolism
   00680 Methane metabolism
    Isova_0381
Enzymes [BR:iva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Isova_0381
Lipid biosynthesis proteins [BR:iva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Isova_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N FIST
Motif
Other DBs
NCBI-ProteinID: AEG43178
UniProt: F6FTI5
Position
complement(399332..401359)
Genome map
AA seq 675 aa AA seqDB search
MTDTQPTAGSASPSLENLLHETRAFPPSPEFAAQANAQASLYEEARADRLEFWARQAREL
VTWKKPFTETLDWSGAPVARWFADGTLNAAYNAVDRHVEAGLGDRVAIHFEGEGGDTRTV
TYADLQRDVARAANAIAALGVSAGDRVVIYMPMLVESVVAMLACARLGAPHSVVFGGFSA
DALRSRIADAEATLVITADGGYRRGAPSALKPAVDEALAPKDGEPETTVRNVLVVRRTGQ
DIAWTEGRDVWWHEAVEAADTFHEPTWVEAEHPLFILYTSGTTGKPKGILHTTGGYLTQA
AYTHKYVFDLKPETDVYWCTADIGWVTGHTYVVYGPLLNGATQVLYEGTPDTPHRGRWWE
LVEKYKVSILYTAPTAIRTCMKWGEDIPARFDLSSLRVLGSVGEPINPEAWMWYRRVIGG
DRAPIVDTWWQTETGAIMISPLPGVTATKPGSAQVPLPGIVADVVDDEARPVPNGDGGYL
VLSEPWPSMLRGIWGDLQRFKDTYWSRFEGLYFAGDGAKKDEDGDIWLLGRVDDVMNVSG
HRLSTTEIESALVSHDIVAEAAVVGAADETTGQAVVAFVILRGEHAGRAGTAEGAAAVQE
ELRAHVAKEIGPIAKPRKVLVVPELPKTRSGKIMRRLLRDVAENRTVGDATTLADSSVME
LIAAGLATSKPGSDD
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtgacagacacccagcccaccgcgggcagcgccagccccagcctcgagaacctcctccac
gagacgcgagcgttcccgccgagccccgagttcgcggcccaggccaacgcgcaggcgtcg
ctgtacgaggaggcgagggccgaccgcctggagttctgggcgcggcaggcccgcgagctg
gtcacgtggaagaagccgttcaccgagacgctcgactggtccggggcgccggtcgcgcgg
tggttcgccgacggcacgctcaacgccgcctacaacgccgtcgaccggcacgtcgaggcc
gggctgggcgaccgcgtcgcgatccacttcgagggcgagggcggcgacacccggaccgtg
acgtacgcggacctgcagcgcgacgtcgcgcgcgccgcgaacgcgatcgccgcgctcggc
gtctccgcgggcgaccgcgtcgtgatctacatgcccatgctcgtcgagtcggtcgtcgcg
atgctcgcgtgcgcccgcctcggcgcgccgcactcggtcgtgttcggcgggttctccgca
gacgcgctgcgcagccgcatcgccgacgccgaggcgacgctcgtcatcaccgccgacggc
ggctaccgccgcggcgcgccgtcggcgctcaagccggccgtggacgaggcgctcgcgccc
aaggacggcgagcccgagaccaccgtgcgcaacgtgctcgtcgtgcgccgcaccgggcag
gacatcgcctggaccgagggccgcgacgtctggtggcacgaggccgtcgaggctgccgac
acgttccacgagcccacctgggtcgaggccgagcacccgctgttcatcctctacacctcg
ggcaccaccgggaagcccaagggcatcctgcacaccacgggcggctacctcacccaggcc
gcgtacacgcacaagtacgtgttcgacctcaagcccgagaccgacgtctactggtgcacc
gccgacatcggctgggtcaccgggcacacctacgtcgtctacgggcccctgctcaacggg
gcgacccaggtcctctacgagggcacgcccgacacgccgcaccgcggccgctggtgggag
ctcgtcgagaagtacaaggtctcgatcctctacaccgccccgaccgcgatccgcacgtgc
atgaagtggggcgaggacatcccggcacgcttcgacctgtcgagcctgcgggtgctcggc
tcggtcggcgagcccatcaaccccgaggcgtggatgtggtaccgccgcgtcatcggcggc
gacagggcgccgatcgtcgacacctggtggcagaccgagacgggcgcgatcatgatcagc
ccgctgccgggcgtcaccgcgaccaagccgggctcggcgcaggtgccgctgccgggcatc
gtcgcggacgtggtcgacgacgaggcgcgcccggtgccgaacggcgacggcgggtacctg
gtcctgtccgagccgtggccgtcgatgctgcgcggcatctggggcgacctccagcgcttc
aaggacacctactggtcgcgattcgagggcctctacttcgcgggcgacggcgccaagaag
gacgaggacggcgacatctggctgctcggacgggtcgacgacgtcatgaacgtctcgggc
caccggctgtcgacgacggagatcgagtcggcgctcgtctcgcacgacatcgtggccgag
gccgccgtcgtcggcgccgccgacgagaccaccggccaggcggtcgtcgcgttcgtcatc
ctgcgcggcgagcacgccggccgcgccggcacggccgagggcgccgccgcggtccaggag
gagctgcgggcgcacgtggccaaggagatcggcccgatcgccaagccgcgcaaggtgctc
gtcgtgcccgagctgcccaagacgcggtccggcaagatcatgcgccgcctgctgcgcgac
gtcgcggagaaccgcaccgtgggcgacgcgacgacgctcgccgactcctcggtcatggag
ctcatcgccgcgggcctggcgacgtccaagcccggctccgacgactga

DBGET integrated database retrieval system