KEGG   Isoptericola variabilis: Isova_0704Help
Entry
Isova_0704        CDS       T01520                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
iva  Isoptericola variabilis
Pathway
iva00480  Glutathione metabolism
iva00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Isova_0704
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Isova_0704
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Isova_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AEG43490
UniProt: F6FWR8
Position
complement(746947..747429)
Genome map
AA seq 160 aa AA seqDB search
MSLYDIKLDRMDGSVTSLAELRDRVILVVNVASRCGLAPQYAQLEELQRRYAERGFTVVA
FPSNQFFQELSTDEKVAEFCSSTYGVTFPVLARVKVNGRHTHPLYAELKKTADADGHRGR
IRWNFEKFLVLPGGTVRRFAPRVEPTDPAIVEVIEAHLPT
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctctacgacatcaagctcgaccggatggacggcagcgtcacctcgctcgcggag
ctccgcgaccgcgtgatcctcgtggtcaacgtggcctcgcggtgcgggctggcgccgcag
tacgcgcagctcgaggagctgcagcgccgctacgccgagcgggggttcaccgtggtggcc
ttcccgagcaaccagttcttccaggagctctcgaccgacgagaaggtcgccgagttctgc
tccagcacctacggcgtgacgttccccgtgctggcccgggtcaaggtcaacggccggcac
acccacccgctgtacgcggagctcaagaagaccgccgacgccgacgggcaccgcggccgg
atccggtggaacttcgagaagttcctcgtgctgcccggcggcaccgtgcgccgcttcgcg
ccacgcgtcgagcccacggacccggcgatcgtcgaggtgatcgaggcccacctgccgacg
tag

DBGET integrated database retrieval system