KEGG   Isoptericola variabilis: Isova_1177Help
Entry
Isova_1177        CDS       T01520                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
iva  Isoptericola variabilis
Pathway
iva00230  Purine metabolism
iva00240  Pyrimidine metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01130  Biosynthesis of antibiotics
Module
iva_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
iva_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
iva_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Isova_1177
   00240 Pyrimidine metabolism
    Isova_1177
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:iva04131]
    Isova_1177
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Isova_1177
Membrane trafficking [BR:iva04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Isova_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AEG43947
UniProt: F6FRU6
Position
1290176..1290643
Genome map
AA seq 155 aa AA seqDB search
MTDVAQNTVPAEPTTPAAERTLVLVKPDGVRRGLSGEVLRRIEAKGYTLAAVELKSATPE
LLAEHYAEHAGKPFYGPLVEFMLSGPILAVVAEGQGVIAGFRSLAGATNPTEAAPGTIRG
DLARDWGLKVQQNLVHGSDSVESAEREIALWFPHL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgtcgcgcagaacaccgtgcccgccgagcccaccacccccgccgccgagcgc
acgctcgtcctcgtcaagcccgacggcgtccgccggggcctgtccggcgaggtgctgcgc
cgcatcgaggccaagggctacacgctcgcggccgtcgagctcaagagcgcgacgcccgag
ctcctcgcggagcactacgccgagcacgccggcaagccgttctacggcccgctcgtcgag
ttcatgctctcgggcccgatcctcgccgtcgtggccgagggccagggcgtgatcgccggc
ttccgctcgctcgccggggccaccaacccgaccgaggccgcccccggcacgatccgcggc
gacctggcccgcgactggggcctgaaggtccagcagaacctcgtgcacggctccgactcg
gtcgagtcggccgagcgcgagatcgccctctggttcccgcacctctga

DBGET integrated database retrieval system