KEGG   Isoptericola variabilis: Isova_1465Help
Entry
Isova_1465        CDS       T01520                                 

Definition
(GenBank) glutamate synthase, NADH/NADPH, small subunit
  KO
K00266  glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
iva  Isoptericola variabilis
Pathway
iva00250  Alanine, aspartate and glutamate metabolism
iva00910  Nitrogen metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Isova_1465
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Isova_1465
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Isova_1465
    1.4.1.14  glutamate synthase (NADH)
     Isova_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Fer4_20 NAD_binding_8 Amino_oxidase Pyr_redox_3 FAD_oxidored NAD_binding_7 Pyr_redox FAD_binding_2 DAO HI0933_like FAD_binding_3 Thi4 AlaDh_PNT_C GIDA FMO-like 2-Hacid_dh_C 3HCDH_N F420_oxidored NAD_binding_9 NAD_Gly3P_dh_N Lycopene_cycl TrkA_N NAD_binding_2 IlvN
Motif
Other DBs
NCBI-ProteinID: AEG44226
UniProt: F6FU98
Position
1593909..1595378
Genome map
AA seq 489 aa AA seqDB search
MADPRGFLKVRHRELPPNRPVPVRLRDWKDVRAHLEEGQPFLKEQAGRCMDCGIPFCHQG
CPLGNLIPEWNDLVWRDQWADAIERLHATNNFPEFTGRVCPAPCETSCVLGINQPAVTIK
NVEVSIIDEAFARGLVTPQVPQRLTGSTVAVVGSGPAGLAAAQQLTRAGHTVVVYERDDA
VGGLLRYGIPDFKLEKHHIDRRLAQMEAEGTRFRPGVEIGRDITWDALRRRFDAVVVATG
ATVPRDLALPGRDLGGIHFAMDFLVPANKVVAGRPVPDDVPHAAGKHVVVIGGGDTGSDC
VGTSLRQGAASVTTLAIGKKPPLERPENQPWPTDPILFEVSTSHEEGGERIYLASTVAFL
GDDEGNVRALRVAETEYLPDGRRAPRPGTEREIPADLVLIAMGFTGPETDELVAQTGAET
TGRGLVRRGDDYASSVPGVFVTGDAGRGQSLIVWAIAEGRATAAAVDAYLQGSTELPAPV
GPRTVALRV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccgcgcgggttcctgaaggtgcggcaccgcgagctgccgcccaaccgtccg
gtgccggtccgcctgcgcgactggaaggacgtccgcgcccacctcgaggagggtcagccg
ttcctcaaggagcaggcgggacgctgcatggactgcggcatcccgttctgccaccagggc
tgcccgctcgggaacctcatcccggagtggaacgacctggtgtggcgcgaccagtgggcc
gacgccatcgagcggctccacgcgaccaacaacttcccggagttcacggggcgcgtgtgc
ccggcgccgtgcgagacgagctgcgtgctgggcatcaaccagcccgcggtgacgatcaag
aacgtcgaggtctcgatcatcgacgaggcgttcgcgcgcggtctggtgaccccgcaggtg
ccgcagcgcctcacgggctcgacggtcgcggtcgtcggctcggggccggcgggcctcgcg
gcggcgcagcagctcacgcgcgccggccacaccgtcgtcgtgtacgagcgcgacgacgcc
gtgggcggcctgctgcggtacggcatcccggacttcaagctcgagaagcaccacatcgac
cgccgtctggcgcagatggaggccgagggcacccgcttccgccctggcgtggagatcggc
cgggacatcacgtgggacgcgctgcgccgccggttcgacgcggtcgtggtcgccacgggc
gccacggtcccgcgcgacctcgcgctgcccggccgcgacctcggcggcatccacttcgcg
atggacttcctggtccccgcgaacaaggtggtcgccggccgcccggtccctgacgacgtc
ccgcacgcggcgggcaagcacgtggtcgtcatcggcggcggcgacaccggctccgactgc
gtcggcacctcgctgcgccagggcgcggcgtcggtcacgacgctcgcgatcggcaagaag
ccgccgctcgagcggcccgagaaccagccgtggccgaccgacccgatcctcttcgaggtc
tcgacctcgcacgaggagggcggcgagcgcatctacctcgcgtcgaccgtggcgttcctc
ggcgacgacgagggcaacgtccgcgcgctgcgcgtggcggagaccgagtaccttcccgac
gggcgccgcgcgccccggccgggcaccgagcgggagatcccggcggacctcgtgctgatc
gcgatgggcttcacgggcccggagacggacgagctggtggcccagaccggtgcggagacg
acgggccgcgggctcgtgcgccgcggcgacgactacgcgtcgagcgtcccgggcgtcttc
gtgaccggcgacgccggtcgcgggcagtcgctcatcgtgtgggcgatcgccgagggccgc
gccaccgcggccgccgtcgacgcttacctgcagggcagcaccgagctgcccgccccggtg
ggcccccgcacggtcgccctgagagtatga

DBGET integrated database retrieval system