KEGG   Isoptericola variabilis: Isova_2021Help
Entry
Isova_2021        CDS       T01520                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
iva  Isoptericola variabilis
Pathway
iva00020  Citrate cycle (TCA cycle)
iva00620  Pyruvate metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
iva01130  Biosynthesis of antibiotics
iva01200  Carbon metabolism
Module
iva_M00009  Citrate cycle (TCA cycle, Krebs cycle)
iva_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Isova_2021
   00620 Pyruvate metabolism
    Isova_2021
Enzymes [BR:iva01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Isova_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEG44757
UniProt: F6FPM5
Position
2182337..2183923
Genome map
AA seq 528 aa AA seqDB search
MTSPAQTPRDAASLVQKDTVDVVLIGGGIMSATLGTLIQQLEPTWSIRIYERLDDVALES
SNPWNNAGTGHAALCELNYTPERPDGSIDISKAVRINEQFEASRELWHHLLATGRLADDS
FIHRTPHMTFVRGEENVDYLRRRHATLSAHPLFRDLEFTTDRSVIAQWAPLLTEDRDPSE
PVAATRSTAGTDIDFGNLTRQLVAAMVDQGAELFLQHEVRSIKRTRDGRWRLRVKDRSWN
APQRRSTVTARFVFVGAGGGALPLLQSAGIPEIKGFGGFPISGEFLRTSNPEVVARHHAK
VYGKADVGAPPMSVPHLDTRVVDGKTYLMFGPYAGFSPKYLKKGKYLGLITSLRLDNLGS
MIGAGLKNLDLTRYLVGQLAAAPETKFHALQQFMPTAHPKDWEKITAGQRVQVIKKDADG
KGVLQFGTEVVASADGSIAGLLGASPGASTAVSAMVDVLKRCFPDRFRTWRGTLASMMPS
LDGGVPADAREIETTQDAAAELSAAEITPGPDGVLPASVYESHADSRL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgcctgcacagaccccccgggacgccgcctcgctcgtccagaaggacacggtc
gacgtcgtcctgatcggtggcggcatcatgagcgccacgctcggcacgctgatccagcag
ctcgagccgacgtggtcgatccgcatctacgagcgcctcgacgacgtcgcgctcgagtcg
tcgaacccgtggaacaacgcgggcacggggcacgccgcgctgtgcgagctcaactacacc
cccgagcgccccgacgggtcgatcgacatctccaaggcggtgaggatcaacgagcagttc
gaggcctctcgcgagctgtggcaccacctgctcgcgaccgggcgcctggcggacgactcc
ttcatccaccgcaccccgcacatgacgttcgtgcgcggcgaggagaacgtcgactacctg
cgccgccgccacgcgacactgagcgcgcacccgctgttccgcgacctcgagttcacgacg
gaccgctcggtcatcgcgcagtgggctccgctgctcacggaggaccgcgacccgtccgaa
ccggtcgccgcgacgcgctcgacggccggaacggacatcgacttcggcaacctcacgcgc
cagctcgtcgcggccatggtggaccagggcgccgagctcttcctccagcacgaggtccgc
tcgatcaagcgcacgcgcgacggccgctggcgcctgcgcgtcaaggaccgctcgtggaac
gccccgcagcgccgcagcaccgtcaccgcgcggttcgtgttcgtcggcgcgggcggcggc
gcgctgccgctgctgcagtcggccggcatcccggagatcaagggcttcggcggcttcccc
atctcgggcgagttcctgcgcacctccaaccccgaggtcgtcgcccggcaccacgccaag
gtctacggcaaggccgacgtcggcgcgccgcctatgtcggtgccgcacctcgacacgcgc
gtcgtcgacggcaagacgtacctcatgttcggcccctacgccggcttcagccccaagtac
ctcaagaagggcaagtacctgggcctgatcacgtcgctgcgtctcgacaacctcggctcg
atgatcggggcgggcctgaagaacctcgacctcacccggtacctcgtcggccagctcgcc
gccgcgccggagacgaagttccacgcgctgcagcagttcatgccgaccgcgcaccccaag
gactgggagaagatcaccgccggccagcgcgtccaggtcatcaagaaggacgccgacggc
aagggcgtgctgcagttcggtaccgaggtcgtcgcctcggccgacggctcgatcgcgggt
ctgctcggcgcctcgccgggcgcctcgaccgcggtctcggccatggtcgacgtgctcaag
cggtgcttccccgaccggttccgcacgtggcgcggcacgctcgcctccatgatgccgagc
ctcgacggcggcgtcccggccgacgcccgcgagatcgagacgacgcaggacgcggccgcc
gagctctcggccgccgagatcacgccgggccccgacggggtgctgccggcgtcggtgtac
gagtcgcacgccgactcgcgcctctga

DBGET integrated database retrieval system