KEGG   Isoptericola variabilis: Isova_2287Help
Entry
Isova_2287        CDS       T01520                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
iva  Isoptericola variabilis
Pathway
iva00460  Cyanoamino acid metabolism
iva00500  Starch and sucrose metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Isova_2287
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Isova_2287
Enzymes [BR:iva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Isova_2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: AEG45006
UniProt: F6FR56
Position
complement(2486258..2487733)
Genome map
AA seq 491 aa AA seqDB search
MSTPTDTQTATSARRTFPTDFLWGTATAAYQIEGAATEDGRGPSIWDTFSHTPGRTQDGD
TGDVACDHYHRWPEDVEHLARLGVGAYRLSISWPRVQPGGRGPLNAKGVEFYRRLLEALH
ERGIRPYVTLYHWDLPQELEDAGGWANRDTALAFAEYARHMARELGDRVEVWTTLNEPFC
SSYLGYASGVHAPGRTEPAAALAAVHHLNLAHGLAVQAIRDELPGAKTSVTLNLHVIRPA
DPSSEGDADAVRKIDALANRAFTGPMLDGAYPQDLLDDTAAVTDWSFVQDGDLEQIRQPL
DVLGVNYYSTTLVRKFTGEGAPEQADGHRTTGASPWVGVTDVEFLPQPGPHTEMGWNIEP
AGLTELLLDLARRYPDLPLAVTENGAAFADELTVDGAGRRRVHDERRVRYLHDHVDAVGA
ALDAGADVRGYFAWSLMDNFEWSYGYSKRFGILHVDYPTGERTWKDSAYWYARLAATGTL
PGLTDVEPLDA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacaccgaccgacacccagacggcgacgagcgcgcgacgcacgttcccgaccgac
ttcctgtggggcaccgccaccgcggcctaccagatcgagggcgccgccaccgaggacggt
cgcgggccgtcgatctgggacacgttctcgcacacgcccgggcgcacgcaggacggcgac
acgggcgacgtcgcgtgcgaccactaccaccgctggcccgaggacgtcgagcacctcgcg
cggctgggcgtcggcgcctaccgcctgtcgatctcctggccgcgcgtgcagccgggcggc
cgtggcccgctcaacgccaagggggtcgagttctaccgccggctcctcgaggcgctgcac
gagcgcggcatccgcccctacgtgacgctctaccactgggacctgccgcaggagctcgag
gacgccggcggctgggcgaaccgcgacaccgcgctcgcgttcgccgagtacgcgcgccac
atggcccgcgagctgggggaccgggtcgaggtgtggacgacgctcaacgagccgttctgc
agctcctacctcgggtacgcctcgggcgtgcacgccccgggccgcaccgagccggcggcg
gcgctcgcggccgtgcaccacctcaacctcgcccacggcctcgccgtgcaggcgatccgc
gacgagctgcccggcgcgaagacctcggtcacgctcaacctgcacgtcatccggcccgcg
gacccgtcgtcggagggcgacgccgacgccgtccggaagatcgacgcgctggccaaccgc
gccttcaccgggccgatgctcgacggcgcgtacccgcaggacctgctcgacgacacggcg
gcggtcaccgactggtcgttcgtgcaggacggcgacctcgagcagatccgtcagccgctc
gacgtgctcggcgtcaactactactccacgacgctggtgcggaagttcaccggcgagggc
gcgcccgagcaggcggacggccaccgcaccaccggcgcgtccccgtgggtgggcgtcacg
gacgtcgagttcctgccccagccgggcccgcacaccgagatgggctggaacatcgaaccc
gcgggcctgaccgagctgctgctcgacctggcccgccggtacccggacctgccgctcgcc
gtgacggagaacggcgccgcgttcgccgacgagctcaccgtcgacggcgcgggacgccgt
cgcgtgcacgacgagcggcgcgtgcgctacctgcacgaccacgtcgacgccgtcggcgcg
gcgctcgacgccggagcggacgtccgcgggtacttcgcgtggtcgctcatggacaacttc
gagtggtcctacgggtactccaagcggttcggcatcctccatgtcgactacccgacgggc
gagcgcacgtggaaggactcggcgtactggtacgcacgcctggccgcgacgggcacgctg
ccggggctgacggacgtcgagccgctcgacgcctga

DBGET integrated database retrieval system