KEGG   Isoptericola variabilis: Isova_2296Help
Entry
Isova_2296        CDS       T01520                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
iva  Isoptericola variabilis
Pathway
iva00520  Amino sugar and nucleotide sugar metabolism
iva01100  Metabolic pathways
iva01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:iva00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Isova_2296
Enzymes [BR:iva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Isova_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AEG45015
UniProt: F6FR65
Position
complement(2502781..2504016)
Genome map
AA seq 411 aa AA seqDB search
MTGPDVVLRGRVATPDTLLDDGAVVVRGDRIAWVGPVAHAAAAGFPAVAGEPRPAPGTTL
LPGLVDLHNHGGGGAGFPDVATRDEAMVAVLEHRRHGTTTLLASLVSADRATLLERAELL
AGLADDGEIAGIHAEGPFLSHARRGAHSPAALVPGDAGLVRELAAAARGHLRTMTVAPEV
EGVAGPGGAAEALVEAGAIPSLGHTDGTTEQAEELVAEVVAGLRAAAGPSAPPREMTATH
LFNGMRPLHHRQPGPIAACLAAAARGEMVVELIADDVHLALATVRSVVRTLGADRVALVT
DAMAAAGMADGAYELGPMAVTVRDGVARATDPDHPEGGAIAGGTAHLVDVVRATVAAGIT
LVDAVRSASWVPARVLGLDDVGGLVAGRRADVVVTDRDLRVQRVLRAGAGV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacctgacgtcgtgctgcgcggccgcgtggcgacccccgacacgctgctcgac
gacggcgcggtcgtcgtgcgcggcgaccggatcgcctgggtgggcccggtggcacacgcc
gcggcggccgggttccccgccgtcgccggcgagccccggccggcgccgggcaccacgctg
ctgccgggcctggtcgacctgcacaaccacggcggcgggggagcgggcttcccggacgtc
gccacgcgcgacgaggcgatggtcgccgtgctcgagcaccgccggcacgggacgacgacg
ctgctcgcctccctcgtctcggccgaccgcgcgacgctcctcgagcgcgccgagctgctc
gccggcctcgcggacgacggcgagatcgccgggatccacgccgaggggcccttcctgtcg
cacgcgcgccgcggcgcccacagccccgcggcgctcgtccccggcgacgccgggctcgtg
cgcgagctcgccgccgcggcccgggggcacctgcggaccatgacggtcgcccccgaggtc
gagggcgtcgccggaccgggcggcgccgcggaggcgctcgtcgaggcgggcgcgatcccg
tcgctcggccacaccgacggcacgaccgagcaggccgaggagctcgtcgccgaggtggtc
gcgggcctgcgcgccgcggccggaccgagcgccccgccacgcgagatgaccgcgacccac
ctgttcaacggcatgcggccgctgcaccaccggcagcccggcccgatcgccgcctgcctg
gccgccgcggcccggggcgagatggtcgtcgagctcatcgccgacgacgtccacctcgcg
ctcgccaccgtgcgcagcgtcgtgcgcacgctcggcgccgaccgcgtcgcgctcgtgacc
gacgccatggccgcggcgggcatggccgacggcgcgtacgagctggggccgatggccgtc
accgtgcgcgacggcgtcgcgcgcgcgacggaccccgaccaccccgagggcggcgcgatc
gccggcggcaccgcccacctcgtcgacgtcgtgcgcgccaccgtcgcggccgggatcacg
ctcgtcgacgcggtccgctcggcgtcgtgggtgcccgcgcgcgtgctcgggctcgacgac
gtcggcggcctcgtcgcggggcggcgcgccgacgtcgtcgtcaccgaccgtgacctgcgc
gtgcagcgcgtgctgcgggcgggcgccggcgtctga

DBGET integrated database retrieval system