KEGG   Isoptericola variabilis: Isova_2515Help
Entry
Isova_2515        CDS       T01520                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
iva  Isoptericola variabilis
Pathway
iva00900  Terpenoid backbone biosynthesis
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01130  Biosynthesis of antibiotics
Module
iva_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Isova_2515
Enzymes [BR:iva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Isova_2515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEG45223
UniProt: F6FSR1
Position
complement(2750096..2751034)
Genome map
AA seq 312 aa AA seqDB search
MTSYLAPAPQPSVRVRAPGKVNLSLRVGPVQEDGFHPLVTIFQAVALYEEVTATQVPVGA
GISIAVDGPQADRVPLDETNLAWRAAEALARHTGVEPDVALHVTKGVPVAGGMAGGSADA
AATLVACDALWETGLPRAELAVVAAGLGSDVPFALLGHTAVGTGRGDLLTPAMTRGEFHW
VFAVSDDGLSTPEVYRRFDELTAGQARDVELADEAPLMHALRAGDPHALGAALHNDLEPA
ALSLRPELERTLTLAREGGALGAVVSGSGPTVAALARSRQHALAIAATWTAEGAADTVWC
TTAPAHGARLLT
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcgtacctcgcccccgcgccgcagccgtccgtgcgcgtccgcgcgcccgggaag
gtcaacctctcgctgcgcgtgggaccggtccaggaggacgggttccacccgctcgtgacg
atcttccaggcggtggccctgtacgaggaggtcaccgcgacccaggtgccggtcggcgcc
gggatctcgatcgccgtggacgggccgcaggccgaccgcgtccccctcgacgagaccaac
ctcgcgtggcgggccgccgaggcgctcgcccggcacaccggcgtcgagcccgacgtggcg
ctgcacgtcaccaagggcgtgcccgtcgcggggggcatggccgggggctccgccgacgcc
gcggcgaccctcgtcgcgtgcgacgccctgtgggagacgggactgccccgcgccgagctg
gcggtcgtcgcggccgggctcggctcggacgtgccgttcgcgctgctcgggcacaccgcc
gtcgggacggggcgcggcgacctgctcacgcccgcgatgacgcgcggcgagttccactgg
gtcttcgcggtgtcggacgacgggctctcgacgcccgaggtctaccggcgcttcgacgag
ctcaccgccgggcaggcgcgcgacgtcgagctcgccgacgaggcgccgctcatgcacgcg
ctgcgcgccggcgacccgcacgcgctcggcgccgccctgcacaacgacctggagcccgcg
gccctctcgctgcggcccgagctcgagcggacgctcacgctcgcgcgcgagggcggtgcg
ctcggggccgtcgtgtccggctcggggccgaccgtcgcggcgctcgcgcggtcacggcag
cacgcgctcgccatcgccgcgacctggaccgccgagggcgccgccgacaccgtctggtgc
accaccgcccccgcccacggcgcccgcctgctcacctga

DBGET integrated database retrieval system