KEGG   Izhakiella sp. KSNA2: FEM41_05715Help
Entry
FEM41_05715       CDS       T05975                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
izh  Izhakiella sp. KSNA2
Pathway
izh00670  One carbon pool by folate
izh01100  Metabolic pathways
izh01120  Microbial metabolism in diverse environments
izh01200  Carbon metabolism
Module
izh_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:izh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    FEM41_05715
Enzymes [BR:izh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     FEM41_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA Pox_L5
Motif
Other DBs
NCBI-ProteinID: QCT19186
UniProt: A0A4P8YH82
Position
1235297..1236967
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIARDCAMKPVAEVADALGIDAEDLELYGRYKAKFSDALWSKLDSAPQGKLVLVT
AINPTPAGEGKTTVTVGLGQALSRLGKKAIVALREPSLGPCFGMKGGATGGGYAQLVPME
DLNLHFTGDFHAITAANNLLAALLDNHLHQGNALNIDSQQITFRRCMDINDRALRHTVVG
LGGRVNGVTREDGFMITVASEIMAILCLARDLADLKRRLARMIVAWRRDDTPVTVSDLQV
TGALAALLKDALKPNLVQTLEHSPAIVHGGPFANIAHGCSSVRGTRLALKLADIVVTEAG
FGADLGAEKFFNIKCRASGLRPDAAVLVATVRALKYNGGVAKRELGYENLDALRQGLGNL
GKHIENLHKFGVPVVVTLNVFTSDTDAEHALIDQYCRERGCDLVLSRVWEQGGAGGEALA
LRVVELLENSDIEFRLLYPDALPLAEKIATIATEIYGAQGVSYSPAAHKALKRISDAGMA
SLPICMAKTQYSLSDDPKALGRPEGFRLHIRDVQAAAGAGFVVAYAGDIMTMPGLPATPA
ALNIDIDDNGVISGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatattgagattgcccgcgactgtgcaatgaagccagtcgcggaagtcgcc
gacgcgctgggaatcgacgcggaggatctggaactctacggcagatataaagctaaattt
tccgacgcgctatggagcaagctggattccgctccccagggaaagctggtgctggtcacc
gctattaaccccactccggccggcgaaggcaagaccacggtcaccgttggccttggtcag
gccctgtcccgtctggggaagaaagccatagtcgcgctacgcgaaccctcccttggcccc
tgctttggcatgaaaggcggcgccaccggtggcggatatgcgcaactggtgcccatggaa
gatctcaacctccattttaccggtgacttccacgccattaccgccgccaataacctgctg
gcggcgctgctggataatcatctgcatcagggaaatgccctgaatatcgacagccagcaa
atcaccttcagacgctgcatggatattaatgaccgtgcgttacgccacaccgttgttggc
ttgggcgggcgagttaacggcgtgacgcgtgaagatggtttcatgattacggtggcgtcg
gaaatcatggcgattctgtgtctggcccgagatctggccgatctgaaacgccgtctggcg
cggatgattgtcgcctggcggcgggacgatacgccggttaccgtgagcgacctgcaggtg
acaggcgcgctggcggcgctgcttaaggatgcactgaagcccaatctggttcagaccctg
gagcacagcccggcgattgtacacggcgggcccttcgcgaatatcgctcacggttgcagc
agcgtgcgcggaacccggctggccctgaaactggcggatatcgtggtgaccgaagcgggc
ttcggcgccgatctcggtgccgagaaatttttcaatattaaatgccgcgccagtggatta
cggccggatgccgccgtgctggtggcgacggtcagggcgctgaaatataacggcggcgtg
gcgaagcgtgaactgggttacgagaatctggacgccctgcgccaggggctggggaatctg
ggcaaacatattgaaaacctgcataaatttggcgtgccggtggtggttacgctgaatgtc
tttacctctgataccgatgccgagcatgcgcttatcgaccagtattgtcgggagcgtggt
tgcgatttggtgctgtcccgggtctgggaacagggcggcgccgggggcgaagccctggcg
ctgcgggtcgttgagctgctggaaaattcggatatagagttccgcctgctctatccggat
gcgctgccgctggcagagaaaatcgccaccatcgccacggagatctacggcgcgcaaggc
gtcagttacagcccggcggcgcacaaagcccttaagcgcatcagtgatgccggtatggcg
tcactgcccatctgcatggcgaagactcagtattcattgtcggacgatcccaaagcgctc
gggcgtcccgaagggttccggttgcatatccgggatgttcaggcggcggccggtgccgga
tttgtggtggcttatgccggagacattatgaccatgccaggcctgcctgcgaccccggcg
gcgctgaatatcgatatcgacgataacggcgttatcagcggcctgttctga

DBGET integrated database retrieval system