KEGG   Izhakiella sp. KSNA2: FEM41_08095Help
Entry
FEM41_08095       CDS       T05975                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
izh  Izhakiella sp. KSNA2
Pathway
izh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:izh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FEM41_08095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:izh02000]
    FEM41_08095
Enzymes [BR:izh01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     FEM41_08095
Transporters [BR:izh02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    FEM41_08095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_23 AAA_30 AAA_22 RsgA_GTPase AAA_16 FeoB_N DUF2813 MMR_HSR1 AAA_15 DUF815 MukB DLIC
Motif
Other DBs
NCBI-ProteinID: QCT19618
UniProt: A0A4P8YIM3
Position
1761170..1762669
Genome map
AA seq 499 aa AA seqDB search
MTQPHQALLRTEGLSKSFPGVKALDNVDFSLNRGEIMALLGENGAGKSTLIKALTGVYQP
DRGTIWLDDVAISPKNTAHAQKLGIGTVYQEVNLLPNMSVADNLFIGREPRRFGLLRRKE
METRATELMASYGFSLDVREPLHRFSVAMQQIVAICRAVSLSASVLILDEPTASLDAQEV
ERLFTLMRQLRDRGISLIFVTHFLDQVYAVSDRITVLRNGGFVGCRETRSLPKIELVKMM
LGRDLMDNALRRAGRTQLSDKPVAVFKNYGRKGTVAPFDLAVRPGEIVGLAGLLGSGRTE
TAEVIFGIKPADSGSVQIKGKPQVLRSPWQASCQGIGFCPEDRKTDGIIAAASVRENIML
ALQAQRGWLRPISRKEQNAIAQRFIRQLGIRTPNAEQPVEFLSGGNQQKVLLSRWLLTKP
RFLILDEPTRGIDVGAHAEIIRLVESLCADGLALLVISSELEELVGYADRVIIMRDRQQV
AEIPLHELSVPAIMTAIAA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaccacaccaggcactccttcgtaccgaaggccttagcaaatcctttcccggc
gtaaaggcactggataacgtcgatttttccctgaatcgcggcgagattatggcgctgctg
ggagaaaacggcgccgggaagtcgacgctaatcaaagcgctaaccggcgtgtatcaaccc
gatcgcggtaccatctggctggatgatgtcgcgatttcaccgaaaaacaccgcccacgcg
cagaaattagggatcggcacggtgtatcaggaagtgaatctgctaccgaatatgtcggtg
gcggataatctgtttattggccgcgagccccgccgctttggtctgctcaggcgcaaagaa
atggagacgcgcgccaccgagcttatggcctcttatggcttttcactcgatgtccgcgag
ccgctgcaccggttttctgtcgcgatgcagcagatagtcgccatttgtcgtgcggtctcc
ctttccgccagcgtgctgatcctggatgaacctacggcgagtctggatgcgcaagaagtg
gaacggctgtttacgctgatgcgccagctgcgcgatcgcggcattagcctgatcttcgtg
acgcacttcctggaccaggtttacgcagtcagcgatcgcattaccgtgttgcgcaacggt
ggctttgtgggctgtcgcgaaacccgctctctcccgaaaatcgagctggtaaaaatgatg
ctggggcgcgatctgatggacaacgccttacggcgtgcgggccgcacccaactgagcgat
aaacccgttgcggtgtttaaaaattatggccggaaagggacggtcgctcccttcgatctg
gcggttcgtcccggtgagattgtcggcctggcgggacttttgggctccgggcgaaccgaa
acggcagaagtgatcttcggcattaagcctgcggacagcggcagcgtgcagatcaaaggc
aagccgcaggtactgcggtcgccctggcaggcctcctgccaggggatcggcttttgcccg
gaagacagaaaaaccgacggcattatcgccgctgcgtcggtgcgcgagaatattatgctg
gcgctccaggcccagcgtggctggctgaggcctatctcccgcaaagaacagaatgcgatt
gcgcagcgttttatacgccagcttggcattcgcacgccaaacgccgaacagccggtggag
tttctgtcggggggcaatcagcagaaggtgttgctgtcgcgctggctgctgaccaaacct
cgcttcctgatactcgacgagccaacccgcggcattgatgttggcgctcatgcggaaatt
atccggctggtggagtcgctctgtgccgacggcctggcgctgctggtgatctcttccgag
ctggaagagctggtcggttatgccgatcgcgtcatcattatgcgtgacaggcaacaggtg
gcagaaattccgctgcatgagctgtcggttcccgccatcatgacggccattgcggcataa

DBGET integrated database retrieval system