KEGG   Izhakiella sp. KSNA2: FEM41_22490Help
Entry
FEM41_22490       CDS       T05975                                 

Definition
(GenBank) ABC transporter permease subunit
  KO
K10016  histidine transport system permease protein
Organism
izh  Izhakiella sp. KSNA2
Pathway
izh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:izh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    FEM41_22490
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:izh02000]
    FEM41_22490
Transporters [BR:izh02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    FEM41_22490
   Histidine transporter
    FEM41_22490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Rft-1 DUF872
Motif
Other DBs
NCBI-ProteinID: QCT22219
UniProt: A0A4P8YMZ4
Position
complement(4807319..4808005)
Genome map
AA seq 228 aa AA seqDB search
MLYGYSQVILNGALVTLELALSSLVLAVLIGLAGASAKLSRNRPLAWLFGGYTTLIRGVP
DLVLMLLIFYGLQMALNGVTEALGFTQIDIDPLAAGIVTLGFIYGAYFTETFRGAYMAVP
RGHIEAATAFGMSSAQTFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
HLAGKGTWQPFWFAIVCGIIYLVFTTVSNGVLWLLERRYSAGVRRAEL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacggttattcacaagtcattcttaacggcgcgctggtgaccctggagctggcg
ctcagctccctggtgctggcggtgctgattggcctggcaggcgcttcggcgaagctgtcg
cgtaatcgtcctctggcctggctgttcggcggctatacgaccctgatccgcggcgtgccg
gatctggtgttgatgttgttgatcttctacggtctacagatggcgctgaacggcgtaacc
gaagcgctgggctttacccagatcgatatcgatccgctggcggcagggatcgtaacgctg
ggatttatctatggcgcctactttaccgaaacctttcgcggcgcttatatggcagtcccc
aggggacatatcgaggccgccaccgcgttcggtatgagtagtgcgcaaaccttccgacgt
attctgttccctgccatgatgcgctatgcgctgcctggaattggcaataactggcaggtg
attctgaaggccacggcgctggtgtcgctgctggggctggaggatgtggtaaaagccacc
catctggcgggtaagggaacctggcagccgttctggtttgccattgtctgcggcattatc
tatctggtgttcacgacggtctccaacggcgtgctctggctgcttgagcgtcgttactcg
gcaggcgtcaggagggctgaactgtga

DBGET integrated database retrieval system