KEGG   Janthinobacterium sp. B9-8: VN23_01110Help
Entry
VN23_01110        CDS       T04271                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00562  Inositol phosphate metabolism
jab00564  Glycerophospholipid metabolism
jab00565  Ether lipid metabolism
jab01100  Metabolic pathways
jab01110  Biosynthesis of secondary metabolites
jab02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    VN23_01110
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    VN23_01110
   00565 Ether lipid metabolism
    VN23_01110
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VN23_01110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:jab02042]
    VN23_01110
Enzymes [BR:jab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     VN23_01110
Bacterial toxins [BR:jab02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   VN23_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 CytB6-F_Fe-S GYF_2
Motif
Other DBs
NCBI-ProteinID: AMC33313
UniProt: A0A0X8GM74
Position
complement(278664..280721)
Genome map
AA seq 685 aa AA seqDB search
MKAINRRNFLSLAAKTAGGATALSLIPPSIMKALAIPANSQTGTINDVEHVVILMQENRS
FDHYFGTLHGVRGFGDKLPIPLPSGKSVWHQKDGTGKEMPPYHMDTRLTSAQRVPGTPHL
MPDAQSAWAGGRMDEWPKFKTQYSMGYYRQEDMPFQFALANAFTICDSYHCSFHGGTNPN
RLHLWTGMVDPTGKNGGPVINNDGESKTSPAEYSWTTYPERLEEAGVSWRIYQDANDNFG
DNSLEGFANFRRAKPDSSLWRNGMSTWTMAQFATHAAGGTLPQVSWLVAPAKYSEHPGPS
SPIQGAEYTQQVLNALTANPDTWSKTVLLVMFDENDGFFDHVPPPATPAKNADGSFAGKS
TVDTQLDYHTNGQIYGLGPRVPMYVISPWSKGGWVNSEVFDHTSVIKFLENRFGVFEPNI
SPWRRAVCGDLMSAFNFAAPNDTTVPPMPSTSQADTIVLNQSKLPKPTAPLIPTLPRQNQ
GTRPSRALPYELHTSGRSEAANGKMWLIFSNTGKATGVFHVYDQRHLDRGPRRYTVEPGK
LLSDDWNTTGDQGLYDLWVLGPNGFHRHFKGNTNSQESNPEIRVCYDYVNGDVYLQLQNT
GSKDAALTITANDYRTDGPWPVTIAPSANAEHSWPLYESGHWYDFSVTGSNGFVRRFAGR
VETGRHSISDPTNAGTMMRYRKRAS
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaatcaatcgcagaaatttcttaagccttgcggcaaaaacagcgggtggcgca
acggcactctccttgatcccgcccagtattatgaaagcactggctatcccggcgaattcc
caaaccggcacgatcaacgatgtagagcatgtggtcatcctcatgcaggaaaaccgcagc
tttgatcattactttggcactttgcatggcgtgcgtggctttggcgataagctgcctatt
ccattgcctagcggtaaatcggtttggcaccaaaaagacggcacgggcaaagaaatgccg
ccctaccatatggatacacgcctcaccagcgcccaacgcgtgcccggcacgccacattta
atgcccgatgcgcaaagtgcttgggctggtgggcgtatggatgaatggccaaaatttaaa
acccaatattcgatgggctattaccgccaggaagacatgccttttcaatttgcactggcc
aatgcctttaccatttgcgatagctaccactgctcgtttcatggcggcaccaatcctaac
cgtctacacctctggaccggcatggttgatcccaccggaaaaaacggcggccccgtcatc
aataatgacggagaaagcaaaacctccccggcagaatactcatggaccacatatccggaa
cgccttgaagaggccggtgtcagctggcgtatttatcaagatgccaacgataattttggc
gacaactcactggaaggctttgccaacttccgccgcgccaagccagacagcagcctgtgg
cgtaatggcatgtctacttggacaatggcgcaatttgccacccatgccgcaggtggcacc
ctgccacaagtgtcctggctagtcgctcctgctaaatactccgaacaccccggcccatcc
agcccgattcaaggtgcggaatacacgcaacaagtgctcaacgcactcacggctaatcca
gatacttggagcaaaacagtattgctggtgatgtttgatgaaaacgatggcttttttgat
catgtaccgccccctgccacccctgctaaaaatgctgacggcagctttgcaggcaaatca
accgtcgacacccagcttgattaccataccaacggccagatttacggcctgggcccacgc
gtgccgatgtatgtaatttcaccttggagcaagggtggctgggtgaattcggaagtattc
gatcacacctcggtgattaaatttctggaaaaccgctttggtgtattcgagcccaatatc
agcccatggcgacgtgctgtgtgtggtgatttaatgtcggcatttaactttgccgcgccc
aatgacaccaccgtgccgcccatgcccagcaccagccaggccgatacaattgtgctcaac
caaagtaagctccccaagcccaccgcaccacttattccaaccttgccacgacaaaaccaa
ggcacgcggccatcccgcgccctgccatatgaattacacaccagtggccgcagcgaagcg
gccaacggcaagatgtggttaatttttagtaacacgggcaaagcgacgggcgtgtttcat
gtctacgatcagcggcatctcgatcgtggcccgcgccgctataccgtcgagcctggcaag
ctgttatcagatgattggaataccaccggcgatcaaggcttatacgatttatgggtgctg
gggcccaacggctttcatcgccactttaaaggcaataccaacagccaggaaagcaatccg
gaaatccgtgtttgctacgactacgtgaatggcgatgtttacttgcagctgcaaaacacc
ggcagcaaggatgcagcactcaccatcaccgccaacgactaccgtaccgacggcccctgg
ccagtcaccatcgcgcctagcgcaaatgcagaacactcatggcctttatacgaaagtggc
cattggtacgactttagcgtaacgggcagcaatggctttgtacgccgctttgccgggcgg
gtagagaccggaagacactcgatcagcgacccgaccaatgcaggaacaatgatgaggtat
agaaaacgagccagttaa

DBGET integrated database retrieval system