KEGG   Janthinobacterium sp. B9-8: VN23_02850Help
Entry
VN23_02850        CDS       T04271                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00450  Selenocompound metabolism
jab00970  Aminoacyl-tRNA biosynthesis
jab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VN23_02850
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VN23_02850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jab01007]
    VN23_02850
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jab03016]
    VN23_02850
Enzymes [BR:jab01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VN23_02850
Amino acid related enzymes [BR:jab01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VN23_02850
Transfer RNA biogenesis [BR:jab03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VN23_02850
 Prokaryotic type
   Other AARSs
    VN23_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AMC33607
UniProt: A0A0X8GJ71
Position
complement(642805..644853)
Genome map
AA seq 682 aa AA seqDB search
MPRKILVTSALPYANGAIHLGHLVEYIQTDIWVRFQKQRGNQCHYVCADDTHGTPVMLRA
EKEGLTPEALIARVHGEHTRDFAGFHVDFDNFYSTNSPENRELAYRIYGKLKENDKIASR
TINQLYDPVKNMFLPDRFVKGECPKCAAKDQYGDNCEVCGATYSPTELKNPYSAVSGATP
ELRESEHYFFKLGECEDFLKEWTTTPGKLQKEASNKMQEWFEAGLSDWDISRDAPYFGFE
IPDAPGKYFYVWLDAPVGYMASHKNLCDRLGLDFDSYWSKDSDAELYHFIGKDILYFHAL
FWPAMLEYAGYRTPTAIHAHGFLTVDGAKMSKSRGTFITAESYLKHLNPEWLRYYFAAKL
GSGVDDLDLNLEDFSARVNSDLIGKYVNIASRAAGFISKRFEGRLHDGIFTATDYPLMDR
IVALQGQLQGAGEKLAVLFEAREYGRAIREIMALTDEVNQYVDSVKPWAMAKDPEQSLHL
HVVCSFLINAFRILTIYLKPVLPKLAADVEQFLNVAPFTWDDAQVLLLDHTIETYQHLMT
RIDPKDIAAMVEENKQNLEATAPVAKPDYEIPPIEETISIDDFMKIDLRVAMITEAKAVE
GADKLVSLTLDIGNETRHVFAGIKAAYKPEDLQGRMTVMVANLAPRKMKFGISEGMVLAA
GGDGGLYILSPDTGAKPGMRVK
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcaagattctcgttacctcagcccttccctacgccaatggtgcgattcacctt
ggccaccttgttgaatatatccaaacggatatctgggtgcgttttcaaaagcaacgtgga
aatcaatgccattacgtctgtgcagatgacacacacggcacgccagttatgctgcgcgcc
gaaaaagaaggcctgacaccagaagcgctgattgcacgcgtacacggcgaacacacccgt
gatttcgcaggctttcatgttgattttgataatttttactcgaccaattcaccagaaaac
cgcgagctggcttatcgtatttacggcaaattaaaagaaaacgacaagatcgccagccgc
acaattaatcagttatacgatcctgttaaaaacatgtttttgccagaccgctttgttaaa
ggcgaatgcccaaagtgcgcggctaaagatcaatacggggataattgtgaagtctgtggc
gcaacatatagcccaaccgaactcaaaaacccgtactcggctgtttcaggtgcaacacca
gagctgcgcgaatcggaacactatttctttaaactaggcgaatgcgaagacttcctgaaa
gaatggaccaccacgcccggcaagctgcaaaaagaagcatctaacaagatgcaggaatgg
tttgaagcgggtctttcagactgggatatcagccgcgatgcgccttattttggctttgag
atcccggatgcgccaggcaagtatttctatgtttggctcgatgcgccggttggctatatg
gccagccacaaaaatctgtgcgatcgccttggcttagattttgatagctattggagtaaa
gattctgatgccgagctgtatcactttatcggcaaagatattctgtatttccacgcacta
ttttggccagccatgctggaatacgcaggctaccgcacgccgactgccattcacgcccac
ggctttttgaccgtagacggcgcaaaaatgagcaaatcgcgcggcacctttattaccgcc
gaatcctaccttaagcatctaaaccctgaatggctacgttattactttgcggcaaaatta
ggcagcggcgtggatgatctggatttaaatctggaagacttcagcgcccgtgttaattcg
gatctgatcggtaaatacgtcaatatcgccagccgcgcagcaggctttatcagcaagcgc
tttgaaggccgcttgcacgatggcattttcaccgccaccgattacccactgatggatcgc
attgtggcgctgcaaggccaattgcaaggcgctggcgaaaagctagccgtgctttttgaa
gcacgcgaatatggccgagcgattcgtgaaattatggcgctgaccgatgaagtcaatcag
tacgtcgatagcgtaaagccttgggcgatggcaaaagaccctgagcagagcctgcatctg
catgtggtttgcagcttcttgatcaatgctttccgtattctgactatttaccttaaaccg
gtgctgcctaagctggctgccgatgtagagcaatttttgaatgttgccccgtttacatgg
gacgatgcgcaggtcttgctgctagatcacaccatagagacttaccagcacttaatgacc
cgaatcgatccaaaagacattgccgccatggttgaagaaaataagcaaaatctggaagcc
actgctcctgtcgccaagccagattatgaaatcccgccgattgaagaaaccatcagcatc
gatgattttatgaaaatcgatctgcgcgtggccatgattaccgaagctaaagccgtagaa
ggcgcggataaattggtttccttaacgctggatatcggcaacgaaacccgccatgtattt
gccggtatcaaggccgcgtataagccggaagacttgcaaggccgcatgaccgtgatggtg
gctaatcttgcgccgcgcaaaatgaaattcggcatatccgaaggcatggtgctagccgcc
ggtggtgacggtggcttgtatatcctgagcccggataccggagccaagcctggtatgcgc
gtgaaataa

DBGET integrated database retrieval system