KEGG   Janthinobacterium sp. B9-8: VN23_05210Help
Entry
VN23_05210        CDS       T04271                                 

Definition
(GenBank) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00350  Tyrosine metabolism
jab00360  Phenylalanine metabolism
jab00380  Tryptophan metabolism
jab01100  Metabolic pathways
jab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VN23_05210
   00360 Phenylalanine metabolism
    VN23_05210
   00380 Tryptophan metabolism
    VN23_05210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jab04147]
    VN23_05210
Enzymes [BR:jab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     VN23_05210
    4.1.1.105  L-tryptophan decarboxylase
     VN23_05210
Exosome [BR:jab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VN23_05210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF412
Motif
Other DBs
NCBI-ProteinID: AMC34035
UniProt: A0A109RV14
Position
1175845..1177239
Genome map
AA seq 464 aa AA seqDB search
MQQDFERALAEVSEWMNDYQQNVADYPVIAALKGGDILQQIPDFAPKDAEHFSGIFADFK
KIIVPGVSHWQHPQFFGYFPSNTSPPSVLAEMLVASLGVQCMSWLTSPAATELEIRMMEW
LRDLWGLPEAFSGVIQDSASSSTLIALLVAREKATQFEINQTGVAGHKLSAYCSSEAHTS
IEKAIKIAGVGQQNLRKIPVDEHQSIRIDLLQKAIAEDIEQGFTPFFMVGALGTTGSTAV
DDLSAMAKIAKAQQIWFHIDAAYAGSALMLPEVRQLAAGYTEADSMVVNPHKWLLCNFDC
SAFFIRDKESLLKTFTLGLIPEYLKSPNSTDQTNFMNWGVGLGRRFRALKLWFVIRWYGT
NGLRDLITHHLDLSAELERWIRQDPHFEVVAQRHFNLLCFRLKASDDVNMELLRRINASG
KVFMTHTKINHQLALRMVTGQTEVNQQHVLEAWQLIQSQAKYLM
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaagactttgaacgggccttggccgaagtcagcgaatggatgaatgattatcag
cagaatgtcgctgattatccggtgattgccgcattaaaaggcggtgatattttgcagcag
attcccgattttgcgcccaaagatgccgagcatttctctggaatttttgccgattttaaa
aagattattgtgccgggcgttagccattggcagcatccgcaattttttgggtatttccct
tccaataccagcccgccttcggtactagctgaaatgctggtggccagccttggcgtgcaa
tgcatgagctggctaacatcgcctgccgcgacagaattagaaatcagaatgatggagtgg
ctgcgcgatttatggggcttgcctgaggcattttcgggggtgattcaggattccgcatca
agctccactctgattgcgcttttggtagcaagggagaaagcgacgcagtttgaaattaat
caaacgggtgtggcagggcataaattaagtgcctactgctcatccgaagcgcatacctcg
attgaaaaagcgatcaagattgccggtgtagggcagcaaaatctaagaaaaatccctgtt
gatgagcatcagtcgatacggattgatctcttgcaaaaagccattgcagaggatatcgag
caaggctttacgccgtttttcatggtgggtgcattgggcacaacaggcagcacggccgtt
gatgatttatccgcgatggctaaaatcgccaaagcgcagcagatctggtttcatatcgac
gccgcctacgccggatcggcgctgatgttgcccgaggtgcggcaattggcggcagggtat
accgaggccgatagcatggtggtgaatccgcataaatggctgctatgcaattttgattgt
tcggcgttttttattcgcgataaagaaagcctgctcaaaacatttacgctgggcctgatt
cctgaatatttaaaatcccccaatagcaccgatcaaactaattttatgaattggggcgtg
ggtcttgggcggcgattcagggcattgaagctttggtttgtgatacgttggtatggcaca
aatggcttaagggatttgattactcatcatcttgatttaagcgccgagctagagcgctgg
ataaggcaagacccacattttgaagttgttgcccagcggcactttaatctgctctgcttt
cgcttaaaagccagtgacgacgtcaatatggagctgctgcgccgtatcaatgccagcggt
aaagtgtttatgactcataccaaaatcaaccatcaattggccctcaggatggtgactggc
caaacggaagtcaatcagcagcatgtattagaggcttggcagttgattcaaagccaagca
aaatatttaatgtaa

DBGET integrated database retrieval system