KEGG   Janthinobacterium sp. B9-8: VN23_13160Help
Entry
VN23_13160        CDS       T04271                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
jab  Janthinobacterium sp. B9-8
Pathway
jab00480  Glutathione metabolism
jab00590  Arachidonic acid metabolism
jab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jab00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    VN23_13160
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VN23_13160
Enzymes [BR:jab01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VN23_13160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AMC35495
UniProt: A0A0X8GMT2
Position
complement(2920973..2921452)
Genome map
AA seq 159 aa AA seqDB search
MSNIGNFSVQGIAGETVDLAQYTGSVVLVVNVASQCGFTPQYEGLQALYEQYKDRGLVVL
GFPCNQFGAQEPGSEAEILDFCTTKFNVSFPLFAKLDVNGENASPLFTWLKEEKPGLLGI
EAVKWNFSKFLLDKQGKVVDRFAPMTKPEDLSAEIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcggtaattttagcgtgcaaggcatagcaggggaaacggttgatttggct
cagtacaccggttcagtggttctagtggtgaatgtggcaagccaatgtggttttaccccg
cagtacgaaggtttacaagcgctctatgagcagtataaagaccgtggcttggtggtgctg
ggctttccgtgcaatcagttcggtgcgcaagaaccgggtagtgaggcggaaattctggat
ttttgtacgactaaatttaacgtgagttttccgctgtttgccaagctggatgtgaacggt
gaaaacgcttcgccgctctttacttggttgaaggaagagaagccgggtttgttgggcatt
gaggcggtgaaatggaatttcagtaaatttttactagataagcaaggtaaagtggttgat
cgctttgctccgatgacaaaaccagaagatctaagtgccgagattgaaaagctgctgtaa

DBGET integrated database retrieval system